Result : B7IFA7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 10 kDa chaperonin (GroES protein) (Protein Cpn10) |
| NCBI Accession ID | CP001185.1 |
| Organism | Thermosipho africanus (strain TCF52B) |
| Left | 268874 |
| Right | 269146 |
| Strand | - |
| Nucleotide Sequence | ATGAAGGTTATTCCATTGGGATCAAGACTTTTAATTAAGCCAATTCAGGAGGAAAAGAGAACTGAAGGAGGAATTGTTCTTCCAGATACTGCAAAAGAAAAACCTATGAAAGCAGAAATTGTTGCAGTAGGTAACTTAGAAGATGCAGACGTTGATCTTCACGTAGGTGATAAAGTAATCTTTTCCAAATATTCAGGAACCGAAATTAAGATAGAGGAAGAAGATTACATAATAATTGATGTAGAAGATATTCTAGCAAAAATAGAAGACTAA |
| Sequence | MKVIPLGSRLLIKPIQEEKRTEGGIVLPDTAKEKPMKAEIVAVGNLEDADVDLHVGDKVIFSKYSGTEIKIEEEDYIIIDVEDILAKIED |
| Source of smORF | Swiss-Prot |
| Function | Binds to Cpn60 in the presence of Mg-ATP and suppresses the ATPase activity of the latter. {ECO:0000255|HAMAP-Rule:MF_00580}. |
| Pubmed ID | 19124572 |
| Domain | CDD:415587 |
| Functional Category | Others |
| Uniprot ID | B7IFA7 |
| ORF Length (Amino Acid) | 90 |
++ More..
| Conservation Analysis |
No. of Species: 210
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 268874 | 269146 | - | NC_011653.1 | Thermosipho africanus TCF52B |
| 2 | 1745333 | 1745602 | + | NC_012785.1 | Kosmotoga olearia TBF 19.5.1 |
| 3 | 988381 | 988650 | - | NZ_CP011232.1 | Kosmotoga pacifica |
| 4 | 57317 | 57589 | - | NZ_CP007389.1 | Thermosipho melanesiensis |
| 5 | 343947 | 344216 | + | NZ_AP014510.1 | Thermotoga profunda AZM34c06 |
| 6 | 590245 | 590514 | - | NZ_LN824141.1 | Defluviitoga tunisiensis |
| 7 | 1752351 | 1752620 | - | NC_015707.1 | Pseudothermotoga thermarum DSM 5069 |
| 8 | 30761 | 31030 | + | NC_017095.1 | Fervidobacterium pennivorans DSM 9078 |
| 9 | 29154 | 29423 | + | NZ_CP014334.1 | Fervidobacterium islandicum |
| 10 | 31827 | 32096 | - | NZ_AP014509.1 | Thermotoga caldifontis AZM44c09 |
| 11 | 961369 | 961638 | + | NZ_AP018712.1 | Tepiditoga spiralis |
| 12 | 286461 | 286736 | + | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 13 | 402979 | 403254 | - | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 14 | 413103 | 413378 | - | NC_023151.1 | Thermotoga maritima MSB8 |
| 15 | 516686 | 516952 | + | NZ_AP019551.1 | Athalassotoga saccharophila |
| 16 | 1240829 | 1241098 | + | NC_010003.1 | Petrotoga mobilis SJ95 |
| 17 | 335935 | 336204 | - | NC_009828.1 | Pseudothermotoga lettingae TMO |
| 18 | 330419 | 330688 | - | NC_022792.1 | Pseudothermotoga elfii DSM 9442 = NBRC 107921 |
| 19 | 26125 | 26394 | - | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
| 20 | 1676575 | 1676844 | - | NC_009718.1 | Fervidobacterium nodosum Rt17-B1 |
| 21 | 1976976 | 1977245 | + | NC_016751.1 | Marinitoga piezophila KA3 |
| 22 | 423791 | 424075 | + | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
| 23 | 34354 | 34641 | + | NC_007517.1 | Geobacter metallireducens GS-15 |
| 24 | 274127 | 274411 | + | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 25 | 1431569 | 1431853 | + | NC_010337.2 | Heliomicrobium modesticaldum Ice1 |
| 26 | 3973604 | 3973894 | + | NZ_CP012333.1 | Labilithrix luteola |
| 27 | 9503861 | 9504151 | - | NZ_CP012333.1 | Labilithrix luteola |
| 28 | 559633 | 559899 | + | NZ_CP007514.1 | Rubrobacter radiotolerans |
| 29 | 175731 | 176021 | + | NC_013960.1 | Nitrosococcus halophilus Nc 4 |
| 30 | 2939512 | 2939796 | - | NZ_CP045875.1 | Heliorestis convoluta |
| 31 | 4972259 | 4972549 | + | NC_009483.1 | Geobacter uraniireducens Rf4 |
| 32 | 31399 | 31686 | - | NZ_CP009788.1 | Geobacter pickeringii |
| 33 | 3664908 | 3665195 | + | NC_002939.5 | Geobacter sulfurreducens PCA |
| 34 | 769041 | 769325 | + | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 35 | 409962 | 410252 | + | NC_018024.1 | Acetomicrobium mobile DSM 13181 |
| 36 | 640136 | 640426 | + | NC_016148.1 | Thermovirga lienii DSM 17291 |
| 37 | 300963 | 301229 | + | NC_014960.1 | Anaerolinea thermophila UNI-1 |
| 38 | 3121546 | 3121830 | - | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 39 | 2309526 | 2309792 | - | NC_008148.1 | Rubrobacter xylanophilus DSM 9941 |
| 40 | 3122188 | 3122481 | - | NC_006177.1 | Symbiobacterium thermophilum IAM 14863 |
| 41 | 607957 | 608247 | + | NC_014011.1 | Aminobacterium colombiense DSM 12261 |
| 42 | 7194007 | 7194297 | + | NZ_CP016211.1 | Minicystis rosea |
| 43 | 5332284 | 5332571 | - | NC_011768.1 | Desulfatibacillum aliphaticivorans |
| 44 | 4151469 | 4151717 | + | NC_011891.1 | Anaeromyxobacter dehalogenans 2CP-1 |
| 45 | 3056112 | 3056402 | - | NC_017030.1 | Corallococcus coralloides DSM 2259 |
| 46 | 7083143 | 7083433 | - | NZ_CP022163.1 | Melittangium boletus DSM 14713 |
| 47 | 110407 | 110697 | + | NC_022664.1 | Spiribacter curvatus |
| 48 | 581920 | 582216 | + | NC_011295.1 | Coprothermobacter proteolyticus DSM 5265 |
| 49 | 3069338 | 3069625 | - | NC_008609.1 | Pelobacter propionicus DSM 2379 |
| 50 | 476289 | 476579 | - | NC_011979.1 | Geobacter daltonii FRC-32 |
| 51 | 36202 | 36459 | - | NC_011661.1 | Dictyoglomus turgidum DSM 6724 |
| 52 | 2472818 | 2473108 | + | NC_013223.1 | Desulfohalobium retbaense DSM 5692 |
| 53 | 2538601 | 2538891 | + | NC_014216.1 | Desulfurivibrio alkaliphilus AHT 2 |
| 54 | 154108 | 154338 | + | NC_013385.1 | Ammonifex degensii KC4 |
| 55 | 2043787 | 2044077 | + | NZ_CP026328.2 | Acidithiobacillus caldus |
| 56 | 1696693 | 1696962 | - | NC_011297.1 | Dictyoglomus thermophilum H-6-12 |
| 57 | 17813 | 18103 | + | NZ_AP012273.1 | Thiolapillus brandeum |
| 58 | 10042025 | 10042315 | + | NZ_CP012159.1 | Chondromyces crocatus |
| 59 | 684092 | 684376 | + | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 60 | 891678 | 891968 | - | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
| 61 | 1293169 | 1293402 | - | NC_011959.1 | Thermomicrobium roseum DSM 5159 |
| 62 | 205787 | 206071 | + | NC_011899.1 | Halothermothrix orenii H 168 |
| 63 | 476101 | 476391 | - | NC_011761.1 | Acidithiobacillus ferrooxidans ATCC 23270 |
| 64 | 2366796 | 2367065 | + | NC_017934.1 | Mesotoga prima MesG1.Ag.4.2 |
| 65 | 651973 | 652257 | + | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 66 | 1754787 | 1755071 | - | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 67 | 608254 | 608538 | + | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 68 | 4323965 | 4324255 | + | NZ_CP026538.1 | Desulfovibrio carbinolicus |
| 69 | 297664 | 297954 | - | NC_012796.1 | Desulfovibrio magneticus RS-1 |
| 70 | 1704043 | 1704333 | - | NZ_AP018795.1 | Acidithiobacillus ferridurans |
| 71 | 2078799 | 2079068 | - | NZ_LS974202.1 | Mesotoga infera |
| 72 | 1903542 | 1903826 | - | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 73 | 3876577 | 3876816 | - | NC_017079.1 | Caldilinea aerophila DSM 14535 = NBRC 104270 |
| 74 | 2145951 | 2146235 | - | NC_008593.1 | Clostridium novyi NT |
| 75 | 2914010 | 2914294 | - | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 76 | 2243303 | 2243593 | - | NZ_CP031115.1 | Rubrobacter indicoceani |
| 77 | 743207 | 743491 | + | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 78 | 665431 | 665715 | + | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 79 | 934504 | 934737 | + | NC_013523.1 | Sphaerobacter thermophilus DSM 20745 |
| 80 | 2116046 | 2116330 | - | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 81 | 2505990 | 2506280 | + | NZ_CP045571.1 | Acidithiobacillus thiooxidans ATCC 19377 |
| 82 | 89351 | 89620 | + | NZ_CP054012.1 | Parabacteroides distasonis |
| 83 | 1232556 | 1232816 | + | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 84 | 972008 | 972286 | - | NZ_CP027228.1 | Mogibacterium diversum |
| 85 | 580037 | 580321 | + | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 86 | 862454 | 862738 | + | NZ_CP007032.1 | Desulfitobacterium metallireducens DSM 15288 |
| 87 | 2696606 | 2696890 | - | NC_015172.1 | Syntrophobotulus glycolicus DSM 8271 |
| 88 | 1683235 | 1683519 | - | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 89 | 956095 | 956325 | + | NZ_CP036259.1 | Sporomusa termitida |
| 90 | 794812 | 795042 | + | NC_015437.1 | Selenomonas sputigena ATCC 35185 |
| 91 | 319311 | 319601 | + | NZ_CP045508.1 | Desulfolutivibrio sulfoxidireducens |
| 92 | 667466 | 667747 | - | NZ_CP029462.1 | Megasphaera stantonii |
| 93 | 594609 | 594863 | - | NC_014212.1 | Meiothermus silvanus DSM 9946 |
| 94 | 245941 | 246234 | - | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 95 | 488686 | 488970 | + | NZ_CP017237.1 | Moorella thermoacetica |
| 96 | 69478 | 69726 | - | NC_022600.1 | Gloeobacter kilaueensis JS1 |
| 97 | 1261530 | 1261790 | - | NZ_CP007773.1 | Campylobacter subantarcticus LMG 24377 |
| 98 | 3580780 | 3581064 | - | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 99 | 3073487 | 3073798 | - | NZ_CP012373.2 | Beggiatoa leptomitoformis |
| 100 | 4272968 | 4273255 | - | NZ_CP015249.1 | Dokdonella koreensis DS-123 |
| 101 | 4872432 | 4872692 | - | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 102 | 3829264 | 3829533 | - | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 103 | 2143329 | 2143619 | + | NC_015388.1 | Desulfobacca acetoxidans DSM 11109 |
| 104 | 2569374 | 2569652 | + | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 105 | 346656 | 346967 | - | NZ_CP071057.1 | Marinicauda algicola |
| 106 | 2993590 | 2993880 | - | NC_013173.1 | Desulfomicrobium baculatum DSM 4028 |
| 107 | 268953 | 269237 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 108 | 414020 | 414274 | - | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 109 | 2126657 | 2126944 | - | NZ_CP039543.1 | Desulfovibrio marinus |
| 110 | 328063 | 328305 | + | NZ_CP029187.1 | Flavobacterium pallidum |
| 111 | 30071 | 30325 | - | NZ_CP010822.1 | Thermus aquaticus Y51MC23 |
| 112 | 538127 | 538408 | + | NZ_CP035130.1 | Gudongella oleilytica |
| 113 | 3723749 | 3724036 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 114 | 334276 | 334551 | + | NZ_CP028811.1 | Flavobacterium magnum |
| 115 | 476331 | 476612 | - | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 116 | 168193 | 168474 | - | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 117 | 25325 | 25582 | - | NC_019386.1 | Thermus oshimai JL-2 |
| 118 | 442959 | 443243 | + | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 119 | 1585513 | 1585785 | + | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 120 | 2001516 | 2001827 | - | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 121 | 1932934 | 1933191 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 122 | 2165659 | 2165931 | + | NC_015164.1 | Phocaeicola salanitronis DSM 18170 |
| 123 | 257093 | 257377 | + | NC_011725.1 | Bacillus cereus B4264 |
| 124 | 3271930 | 3272175 | + | NZ_AP018449.1 | Methylomusa anaerophila |
| 125 | 1124704 | 1124973 | - | NZ_CP022387.1 | Capnocytophaga stomatis |
| 126 | 50818 | 51090 | + | NZ_CP069440.1 | Phocaeicola coprophilus |
| 127 | 4228548 | 4228832 | - | NZ_CP022657.1 | Tumebacillus algifaecis |
| 128 | 212560 | 212841 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 129 | 1427542 | 1427823 | - | NZ_LR134524.1 | Peptoniphilus harei |
| 130 | 255723 | 256007 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 131 | 3802510 | 3802794 | - | NZ_CP019870.1 | Clostridioides difficile |
| 132 | 4941631 | 4941915 | - | NZ_CP020953.1 | Clostridium drakei |
| 133 | 4164349 | 4164633 | - | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 134 | 491292 | 491585 | + | NZ_CP011502.1 | Aeromicrobium erythreum |
| 135 | 1093186 | 1093476 | + | NC_014376.1 | [Clostridium] saccharolyticum WM1 |
| 136 | 22828 | 23112 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 137 | 588979 | 589272 | + | NC_014220.1 | Syntrophothermus lipocalidus DSM 12680 |
| 138 | 3028972 | 3029205 | - | NZ_CP048649.1 | Aminipila butyrica |
| 139 | 258543 | 258827 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 140 | 261813 | 262097 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 141 | 593486 | 593755 | + | NC_019897.1 | Thermobacillus composti KWC4 |
| 142 | 3483572 | 3483850 | - | NZ_CP015067.2 | Elizabethkingia anophelis |
| 143 | 3172978 | 3173256 | + | NZ_CP014337.1 | Elizabethkingia bruuniana |
| 144 | 1104573 | 1104821 | - | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
| 145 | 4677601 | 4677855 | + | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 146 | 2270082 | 2270357 | + | NC_016001.1 | Flavobacterium branchiophilum FL-15 |
| 147 | 2877086 | 2877328 | - | NC_016147.2 | Pseudoxanthomonas spadix BD-a59 |
| 148 | 1614235 | 1614498 | - | NZ_AP019822.1 | Pseudoleptotrichia goodfellowii |
| 149 | 565062 | 565346 | + | NZ_CP053989.1 | Niallia circulans |
| 150 | 2495714 | 2495998 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 151 | 2759086 | 2759370 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 152 | 1759210 | 1759470 | + | NZ_AP021898.1 | Akkermansia muciniphila |
| 153 | 2264983 | 2265267 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 154 | 836611 | 836865 | - | NZ_CP011058.1 | Paenibacillus beijingensis |
| 155 | 2156186 | 2156467 | + | NZ_CP034248.1 | Paenibacillus lentus |
| 156 | 525142 | 525429 | + | NC_012778.1 | [Eubacterium] eligens ATCC 27750 |
| 157 | 1304889 | 1305128 | + | NZ_LT906449.1 | Capnocytophaga haemolytica |
| 158 | 21235 | 21489 | - | NZ_CP043611.1 | Paenibacillus antarcticus |
| 159 | 1928706 | 1928993 | - | NC_014657.1 | Caldicellulosiruptor owensensis OL |
| 160 | 2077823 | 2078110 | - | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
| 161 | 665909 | 666196 | + | NC_014652.1 | Caldicellulosiruptor hydrothermalis 108 |
| 162 | 482652 | 482939 | + | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
| 163 | 614812 | 615099 | + | NC_014720.1 | Caldicellulosiruptor kronotskyensis 2002 |
| 164 | 746448 | 746735 | + | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
| 165 | 2273164 | 2273451 | - | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
| 166 | 1453302 | 1453589 | + | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 167 | 2853666 | 2853938 | - | NC_020134.1 | Thermoclostridium stercorarium subsp. stercorarium DSM 8532 |
| 168 | 5013513 | 5013767 | - | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 169 | 1483669 | 1483950 | + | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 170 | 1157145 | 1157396 | + | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 171 | 4396559 | 4396813 | + | NZ_CP016809.1 | Paenibacillus ihbetae |
| 172 | 1272738 | 1272989 | + | NZ_CP009286.1 | Paenibacillus stellifer |
| 173 | 1341329 | 1341610 | + | NZ_CP009288.1 | Paenibacillus durus |
| 174 | 760334 | 760618 | + | NZ_LS483476.1 | Lederbergia lentus |
| 175 | 2036609 | 2036920 | - | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 176 | 5227020 | 5227274 | + | NZ_CP054614.1 | Paenibacillus barcinonensis |
| 177 | 339663 | 339914 | + | NZ_CP014167.1 | Paenibacillus yonginensis |
| 178 | 2023116 | 2023406 | - | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
| 179 | 2404403 | 2404657 | - | NZ_CP035492.1 | Paenibacillus protaetiae |
| 180 | 128276 | 128497 | - | NZ_CP028105.1 | Fusobacterium ulcerans |
| 181 | 3289098 | 3289370 | - | NZ_CP033433.1 | Cohnella candidum |
| 182 | 3601950 | 3602201 | + | NZ_CP045298.1 | Paenibacillus brasilensis |
| 183 | 1101852 | 1102121 | + | NZ_CP026520.1 | Paenibacillus chitinolyticus |
| 184 | 1434533 | 1434787 | + | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 185 | 934010 | 934273 | + | NC_013192.1 | Leptotrichia buccalis C-1013-b |
| 186 | 4251951 | 4252202 | - | NZ_CP020028.1 | Paenibacillus kribbensis |
| 187 | 3329165 | 3329449 | - | NZ_CP011937.1 | Bacillus velezensis |
| 188 | 796660 | 796944 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 189 | 623752 | 624036 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 190 | 624072 | 624356 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 191 | 649866 | 650150 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 192 | 639216 | 639500 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 193 | 603584 | 603868 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 194 | 1352302 | 1352586 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 195 | 649903 | 650187 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 196 | 1354346 | 1354600 | + | NZ_CP009285.1 | Paenibacillus borealis |
| 197 | 646431 | 646700 | + | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 198 | 3222483 | 3222737 | + | NZ_CP048429.1 | Paenibacillus jilunlii |
| 199 | 1333592 | 1333846 | + | NZ_CP009287.1 | Paenibacillus graminis |
| 200 | 3183403 | 3183657 | + | NZ_CP068595.1 | Paenibacillus sonchi |
| 201 | 3062064 | 3062315 | + | NC_016641.1 | Paenibacillus terrae HPL-003 |
| 202 | 2122782 | 2123066 | - | NZ_LT906444.1 | Listeria welshimeri |
| 203 | 783138 | 783419 | - | NZ_LT906446.1 | Megamonas hypermegale |
| 204 | 838468 | 838731 | + | NZ_AP019846.1 | Leptotrichia hongkongensis |
| 205 | 6242317 | 6242571 | - | NZ_CP034235.1 | Paenibacillus psychroresistens |
| 206 | 1980418 | 1980672 | + | NZ_CP013023.1 | Paenibacillus bovis |
| 207 | 838757 | 839020 | - | NZ_AP019827.1 | Leptotrichia shahii |
| 208 | 1026259 | 1026522 | + | NZ_AP019829.2 | Leptotrichia wadei |
| 209 | 1594880 | 1595143 | - | NZ_AP019845.1 | Leptotrichia trevisanii |
| 210 | 1150239 | 1150490 | + | NZ_CP009428.1 | Paenibacillus odorifer |
| 211 | 2961420 | 2961701 | + | NZ_CP011388.1 | Paenibacillus swuensis |
| 212 | 222487 | 222756 | + | NZ_CP018099.1 | Caldithrix abyssi DSM 13497 |
| 213 | 2118320 | 2118577 | - | NZ_LT859958.1 | Brevefilum fermentans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_011653.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00118.26 | 0.96 | 202 | 47 | same-strand | TCP-1/cpn60 chaperonin family |
++ More..