Result : EXP02782
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02782 |
| NCBI Accession ID | |
| Organism | Odoribacter,Homo |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGATGAAAATGAGATGCACTGTCTGTGATTGGGTATATGAATTGCCGGAAGGCCAAACCGAATTGCCCGCAGATTTTGAATGCGAGCTGTGCGGGGCCGGCCCGGAAGCATTTGTCGTCGTTGAGGAATAA |
| Sequence | MMKMRCTVCDWVYELPEGQTELPADFECELCGAGPEAFVVVEE |
| Source of smORF | Metagenomic Ribo-seq |
| Function | The ORF matches to the profile of cl00202. Profile Description: N/A. Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer. |
| Pubmed ID | 32601270 |
| Domain | CDD:412217 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 43 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1757429 | 1757569 | - | NZ_LT635455.1 | Olsenella timonensis |
| 2 | 132633 | 132749 | + | NZ_AP019309.1 | Intestinibaculum porci |
| 3 | 1427986 | 1428123 | - | NC_013203.1 | Lancefieldella parvulum DSM 20469 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LT635455.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01668.20 | 0.67 | 2 | 425.0 | same-strand | SmpB protein |
++ More..