Protein Information |
Information Type | Description |
---|---|
Protein name | EXP02782 |
NCBI Accession ID | |
Organism | Odoribacter,Homo |
Left | |
Right | |
Strand | |
Nucleotide Sequence | ATGATGAAAATGAGATGCACTGTCTGTGATTGGGTATATGAATTGCCGGAAGGCCAAACCGAATTGCCCGCAGATTTTGAATGCGAGCTGTGCGGGGCCGGCCCGGAAGCATTTGTCGTCGTTGAGGAATAA |
Sequence | MMKMRCTVCDWVYELPEGQTELPADFECELCGAGPEAFVVVEE |
Source of smORF | Metagenomic Ribo-seq |
Function | The ORF matches to the profile of cl00202. Profile Description: N/A. Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer. |
Pubmed ID | 32601270 |
Domain | CDD:412217 |
Functional Category | Conserved domain based functional assignment |
Uniprot ID | |
ORF Length (Amino Acid) | 43 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1757429 | 1757569 | - | NZ_LT635455.1 | Olsenella timonensis |
2 | 132633 | 132749 | + | NZ_AP019309.1 | Intestinibaculum porci |
3 | 1427986 | 1428123 | - | NC_013203.1 | Lancefieldella parvulum DSM 20469 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01668.20 | 0.67 | 2 | 425.0 | same-strand | SmpB protein |