| Protein name |
EXP02769 |
| NCBI Accession ID |
|
| Organism |
Pseudomonas,Flavonifractor,Enterobacter,Bradyrhizobium |
| Left |
|
| Right |
|
| Strand |
|
| Nucleotide Sequence |
ATGAGAGACAAAATCGCAAAATGGTACGCGCAAGGGCTGTGGACCGCCGACATGGTGCGCAGCGCCGTAAAAAAGGGCGTTCTGACCGAGGGGGAGGCGGCGGAGATACTCAGCGGCGGGACAACTGCACGATAG |
| Sequence |
MRDKIAKWYAQGLWTADMVRSAVKKGVLTEGEAAEILSGGTTAR |
| Source of smORF |
Metagenomic Ribo-seq |
| Function |
The ORF matches to the profile of cl23995. Profile Description: Phage uncharacterized protein (Phage_XkdX). This model represents a family of small (about 50 amino acid) phage proteins, found in at least 12 different phage and prophage regions of Gram-positive bacteria. In a number of these phage, the gene for this protein is found near the holin and endolysin genes. [Mobile and extrachromosomal element functions, Prophage functions] |
| Pubmed ID |
32601270
|
| Domain |
CDD:420140 |
| Functional Category |
Conserved domain based functional assignment |
| Uniprot ID |
|
| ORF Length (Amino Acid) |
44 |