Result : A1B422
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0235 protein Pden_2174 |
| NCBI Accession ID | CP000489.1 |
| Organism | Paracoccus denitrificans (strain Pd 1222) |
| Left | 2178525 |
| Right | 2178773 |
| Strand | - |
| Nucleotide Sequence | ATGACCGACCTGAGCCATCTTGCCCGGCCCGGCGCCGAAATCGCCGTGCGCGTCACGCCGCGCGCCTCGCGCAATGCGGTGATCCTGGACGGCGAGGCGATCCGCGTCACCGTGACCACGGTGCCCGAGGACGGCAAGGCCAATGCCGCCGTGGTCAAGCTGCTGGCCAAGGCGCTGGGCGTCGCCAAGTCGCGGCTGGTGCTGGTGCGCGGCGCCACCGCCCGCGACAAGCTGTTCCGCATCGACTAG |
| Sequence | MTDLSHLARPGAEIAVRVTPRASRNAVILDGEAIRVTVTTVPEDGKANAAVVKLLAKALGVAKSRLVLVRGATARDKLFRID |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00811. Profile Description: Uncharacterized ACR, YggU family COG1872. hypothetical protein; Validated |
| Pubmed ID | |
| Domain | CDD:412584 |
| Functional Category | Others |
| Uniprot ID | A1B422 |
| ORF Length (Amino Acid) | 82 |
++ More..
| Conservation Analysis |
No. of Species: 52
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 569650 | 569898 | + | NZ_CP045072.1 | Paracoccus kondratievae |
| 2 | 924583 | 924849 | + | NZ_LN832559.1 | Paracoccus aminovorans |
| 3 | 1146438 | 1146641 | + | NZ_CP012661.1 | Defluviimonas alba |
| 4 | 1937196 | 1937447 | + | NZ_CP024422.1 | Paracoccus yeei |
| 5 | 2447906 | 2448157 | + | NZ_CP030239.1 | Paracoccus mutanolyticus |
| 6 | 3386603 | 3386851 | - | NZ_CP053562.1 | Thioclava electrotropha |
| 7 | 3387778 | 3388026 | - | NZ_CP019437.1 | Thioclava nitratireducens |
| 8 | 2533220 | 2533468 | - | NC_022041.1 | Paracoccus aminophilus JCM 7686 |
| 9 | 3566936 | 3567184 | - | NZ_CP015421.1 | Rhodovulum sulfidophilum |
| 10 | 1792948 | 1793157 | - | NZ_CP051181.1 | Thalassobius gelatinovorus |
| 11 | 1386725 | 1386976 | - | NZ_CP025430.1 | Paracoccus zhejiangensis |
| 12 | 569808 | 570059 | + | NZ_CP061202.1 | Rhodobacter capsulatus |
| 13 | 3292022 | 3292279 | - | NZ_CP034588.1 | Silicimonas algicola |
| 14 | 989744 | 990022 | + | NC_003911.12 | Ruegeria pomeroyi DSS-3 |
| 15 | 3487031 | 3487237 | + | NZ_CP049037.1 | Pseudohalocynthiibacter aestuariivivens |
| 16 | 1441599 | 1441856 | + | NZ_CP015093.1 | Salipiger abyssi |
| 17 | 2439342 | 2439545 | - | NZ_CP039964.1 | Pseudorhodobacter turbinis |
| 18 | 3150984 | 3151238 | + | NZ_CP034328.1 | Tabrizicola piscis |
| 19 | 597652 | 597855 | + | NZ_CP032125.1 | Profundibacter amoris |
| 20 | 3849799 | 3850068 | - | NZ_CP045201.1 | Pseudopuniceibacterium antarcticum |
| 21 | 2070519 | 2070773 | - | NZ_CP015230.1 | Epibacterium mobile F1926 |
| 22 | 3572215 | 3572421 | - | NZ_CP060436.1 | Pseudooceanicola algae |
| 23 | 355929 | 356129 | + | NZ_CP012908.1 | Ketogulonicigenium vulgare |
| 24 | 262384 | 262656 | + | NZ_CP065915.1 | Pelagovum pacificum |
| 25 | 180638 | 180886 | - | NZ_CP014327.1 | Halocynthiibacter arcticus |
| 26 | 3216226 | 3216444 | - | NZ_CP033219.1 | Parasedimentitalea marina |
| 27 | 1297095 | 1297295 | - | NZ_CP020470.1 | Rhodobacter blasticus |
| 28 | 3685130 | 3685336 | - | NZ_CP004393.1 | Celeribacter indicus |
| 29 | 2431272 | 2431568 | - | NZ_CP010650.1 | Phaeobacter inhibens |
| 30 | 3699991 | 3700200 | + | NZ_CP022196.1 | Celeribacter ethanolicus |
| 31 | 1015241 | 1015537 | + | NZ_CP021047.1 | Phaeobacter gallaeciensis |
| 32 | 440625 | 440831 | + | NZ_CP035510.1 | Haematobacter massiliensis |
| 33 | 2163372 | 2163584 | - | NZ_CP041159.1 | Leisingera aquaemixtae |
| 34 | 1000808 | 1001020 | + | NC_023135.1 | Leisingera methylohalidivorans DSM 14336 |
| 35 | 245793 | 245993 | + | NZ_CP019937.1 | Ketogulonicigenium robustum |
| 36 | 1948263 | 1948472 | - | NZ_CP025583.1 | Paracoccus jeotgali |
| 37 | 72885 | 73097 | - | NC_007794.1 | Novosphingobium aromaticivorans DSM 12444 |
| 38 | 1888849 | 1889058 | - | NZ_CP042261.1 | Qingshengfaniella alkalisoli |
| 39 | 4058686 | 4058931 | - | NC_010581.1 | Beijerinckia indica subsp. indica ATCC 9039 |
| 40 | 1304118 | 1304387 | - | NZ_CP049250.1 | Rhizobium rhizoryzae |
| 41 | 5578374 | 5578640 | - | NC_013739.1 | Conexibacter woesei DSM 14684 |
| 42 | 1245227 | 1245436 | + | NZ_CP042345.1 | Novosphingobium ginsenosidimutans |
| 43 | 340683 | 340895 | - | NZ_AP019389.1 | Qipengyuania flava |
| 44 | 2386922 | 2387122 | - | NZ_CP009291.1 | Novosphingobium pentaromativorans US6-1 |
| 45 | 828736 | 828987 | - | NZ_AP022603.1 | Mycolicibacterium fallax |
| 46 | 733215 | 733421 | - | NZ_CP016268.1 | Woeseia oceani |
| 47 | 3686220 | 3686426 | + | NZ_CP009122.1 | Sphingopyxis fribergensis |
| 48 | 260424 | 260627 | + | NC_009507.1 | Sphingomonas wittichii RW1 |
| 49 | 9263 | 9466 | + | NZ_CP022749.1 | Sphingobium xenophagum |
| 50 | 97699 | 97902 | + | NZ_CP022747.1 | Sphingobium xenophagum |
| 51 | 2237892 | 2238095 | + | NC_008048.1 | Sphingopyxis alaskensis RB2256 |
| 52 | 379876 | 380079 | + | NZ_CP009429.1 | Sphingopyxis macrogoltabida |
| 53 | 2421191 | 2421412 | - | NZ_CP042829.1 | Tepidiforma bonchosmolovskayae |
++ More..