| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02746 |
| NCBI Accession ID | |
| Organism | |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | GTGACGTTGAAGGATATGGCAAAGAAAAACTACGAGCGCGGCCTTTGGACGGTGGAAATGCTTGCGGCCCTGGTGGAAAAGGGCAAGCTGACGCAGGAGAATGTCCGCGAGCTGACCGGGGCGGCGAAGGCGTAA |
| Sequence | MTLKDMAKKNYERGLWTVEMLAALVEKGKLTQENVRELTGAAKA |
| Source of smORF | Metagenomic Ribo-seq |
| Function | The ORF matches to the profile of cl23995. Profile Description: Phage uncharacterized protein (Phage_XkdX). This model represents a family of small (about 50 amino acid) phage proteins, found in at least 12 different phage and prophage regions of Gram-positive bacteria. In a number of these phage, the gene for this protein is found near the holin and endolysin genes. [Mobile and extrachromosomal element functions, Prophage functions] |
| Pubmed ID | 32601270 |
| Domain | CDD:420140 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 44 |