Result : B7GKZ6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Translational regulator CsrA |
| NCBI Accession ID | CP000922.1 |
| Organism | Anoxybacillus flavithermus (strain DSM 21510 / WK1) |
| Left | 2556915 |
| Right | 2557163 |
| Strand | - |
| Nucleotide Sequence | ATGCTTGTATTAACACGCAAATTAAAAGAAGCGATTCAAATCGGTGATGATATCGAAGTCGTCGTTCTCGCCATCGATGGCGACCAAGTGAAGCTCGGCATTCGCGCACCGAAACATATCGATGTGCATCGCAAAGAAATATATCTCGCCATCCAAGCAGAAAATAACGCTGCCTCTCTCGCCTCTATAACTTCGCTTCAACAGTTATCTGATCAATTAAAGAAAGGAGGGAAGTATGATGAGCGTTAG |
| Sequence | MLVLTRKLKEAIQIGDDIEVVVLAIDGDQVKLGIRAPKHIDVHRKEIYLAIQAENNAASLASITSLQQLSDQLKKGGKYDER |
| Source of smORF | Swiss-Prot |
| Function | A translational regulator that binds mRNA to regulate translation initiation and/or mRNA stability. Usually binds in the 5'-UTR at or near the Shine-Dalgarno sequence preventing ribosome-binding, thus repressing translation. Its main target seems to be the major flagellin gene, while its function is anatagonized by FliW. {ECO:0000255|HAMAP-Rule:MF_00167}. |
| Pubmed ID | 19014707 |
| Domain | CDD:412510 |
| Functional Category | RNA-binding |
| Uniprot ID | B7GKZ6 |
| ORF Length (Amino Acid) | 82 |
++ More..
| Conservation Analysis |
No. of Species: 97
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3154882 | 3155130 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 2 | 138158 | 138406 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 3 | 2012582 | 2012821 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 4 | 691099 | 691338 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 5 | 2335013 | 2335252 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 6 | 825685 | 825927 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 7 | 3195566 | 3195790 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 8 | 4028009 | 4028233 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 9 | 3881618 | 3881845 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 10 | 3498534 | 3498758 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 11 | 3602238 | 3602462 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 12 | 3492638 | 3492862 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 13 | 3457345 | 3457569 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 14 | 3438335 | 3438559 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 15 | 3636046 | 3636270 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 16 | 3512942 | 3513169 | - | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 17 | 3796801 | 3797025 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 18 | 3418172 | 3418396 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 19 | 2620097 | 2620321 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 20 | 3189801 | 3190037 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 21 | 585907 | 586149 | + | NZ_CP012502.1 | Bacillus beveridgei |
| 22 | 2127145 | 2127378 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 23 | 3720287 | 3720514 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 24 | 3385613 | 3385843 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 25 | 4047032 | 4047265 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 26 | 545108 | 545332 | + | NZ_CP011937.1 | Bacillus velezensis |
| 27 | 507557 | 507805 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 28 | 3499317 | 3499541 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 29 | 2871269 | 2871502 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 30 | 4290563 | 4290796 | - | NZ_CP053989.1 | Niallia circulans |
| 31 | 1581359 | 1581589 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 32 | 2872915 | 2873145 | - | NZ_CP029797.1 | Paraliobacillus zengyii |
| 33 | 4850605 | 4850835 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 34 | 661029 | 661256 | + | NZ_CP011361.2 | Salimicrobium jeotgali |
| 35 | 3175744 | 3175962 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 36 | 2811116 | 2811340 | - | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 37 | 395095 | 395328 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 38 | 3067624 | 3067863 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 39 | 2512853 | 2513071 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 40 | 2561561 | 2561785 | - | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 41 | 1017009 | 1017251 | - | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 42 | 2501497 | 2501718 | + | NZ_CP035485.1 | Salicibibacter halophilus |
| 43 | 614490 | 614729 | + | NZ_AP013035.1 | Thermosulfidibacter takaii ABI70S6 |
| 44 | 3487544 | 3487771 | - | NZ_LS483476.1 | Lederbergia lentus |
| 45 | 2612721 | 2612945 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 46 | 2370805 | 2371041 | - | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 47 | 3344894 | 3345121 | + | NC_016620.1 | Halobacteriovorax marinus SJ |
| 48 | 4117067 | 4117285 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 49 | 1309609 | 1309839 | + | NC_023035.1 | Salinispira pacifica |
| 50 | 3979921 | 3980139 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 51 | 118112 | 118342 | + | NZ_CP034235.1 | Paenibacillus psychroresistens |
| 52 | 2693365 | 2693589 | + | NZ_LR130778.1 | Petrocella atlantisensis |
| 53 | 5277197 | 5277433 | - | NZ_CP013023.1 | Paenibacillus bovis |
| 54 | 281384 | 281605 | + | NZ_CP025197.1 | Acetivibrio saccincola |
| 55 | 3369879 | 3370103 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 56 | 1083494 | 1083733 | + | NZ_CP026363.1 | Brevibacillus agri |
| 57 | 2194736 | 2194963 | - | NC_013939.1 | Deferribacter desulfuricans SSM1 |
| 58 | 786433 | 786684 | + | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
| 59 | 1711700 | 1711921 | + | NZ_CP048000.1 | Anaerocolumna sedimenticola |
| 60 | 387891 | 388109 | + | NC_010001.1 | Lachnoclostridium phytofermentans ISDg |
| 61 | 2784134 | 2784385 | - | NC_014364.1 | Sediminispirochaeta smaragdinae DSM 11293 |
| 62 | 7580905 | 7581141 | - | NZ_CP009285.1 | Paenibacillus borealis |
| 63 | 1150025 | 1150255 | + | NZ_CP045851.1 | Actinomarinicola tropica |
| 64 | 371180 | 371401 | + | NZ_LN879430.1 | Herbinix luporum |
| 65 | 877595 | 877846 | - | NZ_AP014509.1 | Thermotoga caldifontis AZM44c09 |
| 66 | 207133 | 207357 | + | NZ_CP016543.2 | Planococcus donghaensis |
| 67 | 200091 | 200312 | + | NZ_CP059540.1 | Planococcus maritimus |
| 68 | 190154 | 190378 | + | NZ_CP019401.1 | Planococcus faecalis |
| 69 | 198739 | 198963 | + | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 70 | 114616 | 114834 | + | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 71 | 187245 | 187469 | + | NZ_CP016537.2 | Planococcus halocryophilus |
| 72 | 178262 | 178486 | + | NZ_CP016540.2 | Planococcus versutus |
| 73 | 203711 | 203932 | + | NZ_CP016539.2 | Planococcus plakortidis |
| 74 | 200237 | 200458 | + | NZ_CP016538.2 | Planococcus maritimus |
| 75 | 3391145 | 3391366 | + | NZ_CP013659.2 | Planococcus rifietoensis |
| 76 | 262089 | 262334 | + | NC_014378.1 | Acetohalobium arabaticum DSM 5501 |
| 77 | 565122 | 565340 | + | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
| 78 | 3436208 | 3436435 | - | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 79 | 2273478 | 2273708 | - | NC_019978.1 | Halobacteroides halobius DSM 5150 |
| 80 | 926283 | 926525 | + | NC_017098.1 | Spirochaeta africana DSM 8902 |
| 81 | 1309436 | 1309675 | + | NZ_CP045875.1 | Heliorestis convoluta |
| 82 | 4012471 | 4012686 | - | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 83 | 1027811 | 1028050 | - | NZ_CP021434.1 | Tumebacillus avium |
| 84 | 903031 | 903258 | + | NZ_CP036150.1 | Oceanispirochaeta crateris |
| 85 | 2148685 | 2148894 | + | NZ_CP048877.1 | Thermosulfuriphilus ammonigenes |
| 86 | 1571353 | 1571586 | - | NC_017583.1 | Spirochaeta thermophila DSM 6578 |
| 87 | 2184910 | 2185131 | - | NC_015500.1 | Treponema brennaborense DSM 12168 |
| 88 | 105176 | 105412 | + | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 89 | 619047 | 619265 | + | NC_014387.1 | Butyrivibrio proteoclasticus B316 |
| 90 | 563117 | 563347 | + | NC_020813.1 | Bdellovibrio exovorus JSS |
| 91 | 1325962 | 1326204 | - | NZ_CP068595.1 | Paenibacillus sonchi |
| 92 | 2956793 | 2957044 | - | NC_019903.1 | Desulfitobacterium dichloroeliminans LMG P-21439 |
| 93 | 4439851 | 4440084 | - | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 94 | 218110 | 218340 | - | NC_014758.1 | Calditerrivibrio nitroreducens DSM 19672 |
| 95 | 1702287 | 1702529 | - | NZ_CP045298.1 | Paenibacillus brasilensis |
| 96 | 452890 | 453120 | - | NZ_CP035108.1 | Geovibrio thiophilus |
| 97 | 4090861 | 4091094 | - | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 98 | 262435 | 262656 | + | NC_012778.1 | [Eubacterium] eligens ATCC 27750 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_006510.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00669.22 | 0.99 | 96 | 854 | same-strand | Bacterial flagellin N-terminal helical region |
| 2 | PF00700.23 | 0.82 | 80 | 1063.0 | same-strand | Bacterial flagellin C-terminal helical region |
| 3 | PF02623.17 | 1.0 | 97 | 2.0 | same-strand | FliW protein |
| 4 | PF20074.1 | 0.61 | 59 | 465 | same-strand | Family of unknown function (DUF6470) |
| 5 | PF00460.22 | 0.78 | 76 | 2026.5 | same-strand | Flagella basal body rod protein |
| 6 | PF05130.14 | 0.84 | 81 | 3607 | same-strand | FlgN protein |
++ More..