Protein Information |
Information Type | Description |
---|---|
Protein name | EXP02739 |
NCBI Accession ID | |
Organism | Fusobacterium,Clostridium,Neisseria,Clostridioides |
Left | |
Right | |
Strand | |
Nucleotide Sequence | ATGAACGACCAACTCGTGATTCACGGGGCCAGAGAAAACAATCTGAAAAACGTGGATTTGACCATTCCCCGGGACAAGCTGGTGGTATTTACCGGTCTGTCCGGCTCGGGCAAATCCTCTCTGGCCTAG |
Sequence | MNDQLVIHGARENNLKNVDLTIPRDKLVVFTGLSGSGKSSLA |
Source of smORF | Metagenomic Ribo-seq |
Function | |
Pubmed ID | 32601270 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 42 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 371989 | 372102 | + | NZ_CP011542.1 | Corynebacterium mustelae |
2 | 970968 | 971096 | - | NZ_CP011855.1 | Spiroplasma atrichopogonis |
3 | 943077 | 943205 | - | NZ_CP002082.1 | Spiroplasma mirum ATCC 29335 |
4 | 1148198 | 1148326 | - | NZ_CP011856.1 | Spiroplasma eriocheiris |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF17760.3 | 0.75 | 3 | 877 | same-strand | UvrA interaction domain |