Result : EXP02739
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02739 |
| NCBI Accession ID | |
| Organism | Fusobacterium,Clostridium,Neisseria,Clostridioides |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGAACGACCAACTCGTGATTCACGGGGCCAGAGAAAACAATCTGAAAAACGTGGATTTGACCATTCCCCGGGACAAGCTGGTGGTATTTACCGGTCTGTCCGGCTCGGGCAAATCCTCTCTGGCCTAG |
| Sequence | MNDQLVIHGARENNLKNVDLTIPRDKLVVFTGLSGSGKSSLA |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 42 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 371989 | 372102 | + | NZ_CP011542.1 | Corynebacterium mustelae |
| 2 | 970968 | 971096 | - | NZ_CP011855.1 | Spiroplasma atrichopogonis |
| 3 | 943077 | 943205 | - | NZ_CP002082.1 | Spiroplasma mirum ATCC 29335 |
| 4 | 1148198 | 1148326 | - | NZ_CP011856.1 | Spiroplasma eriocheiris |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP011855.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF17760.3 | 0.75 | 3 | 877 | same-strand | UvrA interaction domain |
++ More..