| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02730 |
| NCBI Accession ID | |
| Organism | Clostridium |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGAAAAAATTAAGTAATAAGGTATTAATGGCTATTGCAGCTTTTGCTACAGTAATTGCATCTGTAGTGTCAACTTCAGCATGCTTATGGTATATGTATCAACCAGAAGAGCCAAAAGCTTTAAGAGATGAATAA |
| Sequence | MKKLSNKVLMAIAAFATVIASVVSTSACLWYMYQPEEPKALRDE |
| Source of smORF | Metagenomic Ribo-seq |
| Function | The ORF matches to the profile of cl27940. Profile Description: Staphylococcal AgrD protein. Members of this family of short peptides are precursors to thiolactone (unless Cys is replaced by Ser) cyclic autoinducer peptides, used in quorum-sensing systems in Gram-positive bacteria. The best characterized is the AgrD precursor, processed by the AgrB protein. Nearby proteins regularly encountered include a histidine kinase and a response regulator. This model is related to pfam05931 but is newer and currently broader in scope. |
| Pubmed ID | 32601270 |
| Domain | CDD:391800 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 44 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1768569 | 1768703 | - | NZ_CP016786.1 | Clostridium isatidis |
| 2 | 382086 | 382220 | + | NZ_CP011663.1 | Clostridium sporogenes |
| 3 | 2626758 | 2626892 | + | NZ_CP023671.1 | Clostridium septicum |
| 4 | 1281038 | 1281172 | + | NZ_CP014204.2 | Clostridium baratii |
| 5 | 385588 | 385722 | + | NZ_CP028842.1 | Clostridium botulinum |
| 6 | 4519214 | 4519348 | - | NZ_CP043998.1 | Clostridium diolis |
| 7 | 3597979 | 3598125 | - | NZ_CP043998.1 | Clostridium diolis |
| 8 | 2489228 | 2489353 | + | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 9 | 104800 | 104934 | + | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 10 | 1620910 | 1621044 | + | NC_014393.1 | Clostridium cellulovorans 743B |
| 11 | 2052408 | 2052542 | - | NZ_CP027286.1 | Clostridium chauvoei |
| 12 | 2676884 | 2677018 | + | NZ_CP071376.1 | Clostridium gasigenes |
| 13 | 3327233 | 3327355 | - | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 14 | 3106888 | 3107022 | + | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 15 | 2046628 | 2046762 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 16 | 3004841 | 3004951 | - | NZ_CP013019.1 | Clostridium pasteurianum |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00990.23 | 0.79 | 11 | 60 | same-strand | Diguanylate cyclase, GGDEF domain |
| 2 | PF13487.8 | 0.79 | 11 | 60 | same-strand | HD domain |
| 3 | PF01966.24 | 0.79 | 11 | 60 | same-strand | HD domain |
| 4 | PF04647.17 | 0.93 | 13 | 17 | same-strand | Accessory gene regulator B |
| 5 | PF17248.4 | 0.86 | 12 | 1160.0 | same-strand | Family of unknown function (DUF5317) |