Result : EXP02725
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02725 |
| NCBI Accession ID | |
| Organism | Prevotella |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGCCTAACTTTGCCATCGCAAACGCACAAAAGGGCAAATACCAGAGTGGCCAAATGGGGCAGACTGTAAATCTGCTGGCTTACGCCTTCGGTGGTTCGAATCCATCTTTGCCCACCTTCCGGCGCAGGAACTGA |
| Sequence | MPNFAIANAQKGKYQSGQMGQTVNLLAYAFGGSNPSLPTFRRRN |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 44 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1725591 | 1725731 | + | NZ_LR027382.1 | Alistipes megaguti |
| 2 | 1604997 | 1605110 | - | NC_010729.1 | Porphyromonas gingivalis ATCC 33277 |
| 3 | 2681534 | 2681650 | + | NZ_LR134503.1 | Kaistella jeonii |
| 4 | 69853 | 69993 | + | NZ_CP034930.1 | Apibacter raozihei |
| 5 | 433990 | 434106 | + | NC_002163.1 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
| 6 | 1319986 | 1320135 | + | NZ_CP013002.1 | Caulobacter henricii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR027382.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00009.29 | 0.67 | 4 | 286.5 | same-strand | Elongation factor Tu GTP binding domain |
| 2 | PF03143.19 | 0.67 | 4 | 286.5 | same-strand | Elongation factor Tu C-terminal domain |
| 3 | PF03144.27 | 0.67 | 4 | 286.5 | same-strand | Elongation factor Tu domain 2 |
| 4 | PF01926.25 | 0.67 | 4 | 286.5 | same-strand | 50S ribosome-binding GTPase |
++ More..