Protein Information |
Information Type | Description |
---|---|
Protein name | EXP02725 |
NCBI Accession ID | |
Organism | Prevotella |
Left | |
Right | |
Strand | |
Nucleotide Sequence | ATGCCTAACTTTGCCATCGCAAACGCACAAAAGGGCAAATACCAGAGTGGCCAAATGGGGCAGACTGTAAATCTGCTGGCTTACGCCTTCGGTGGTTCGAATCCATCTTTGCCCACCTTCCGGCGCAGGAACTGA |
Sequence | MPNFAIANAQKGKYQSGQMGQTVNLLAYAFGGSNPSLPTFRRRN |
Source of smORF | Metagenomic Ribo-seq |
Function | |
Pubmed ID | 32601270 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 44 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1725591 | 1725731 | + | NZ_LR027382.1 | Alistipes megaguti |
2 | 1604997 | 1605110 | - | NC_010729.1 | Porphyromonas gingivalis ATCC 33277 |
3 | 2681534 | 2681650 | + | NZ_LR134503.1 | Kaistella jeonii |
4 | 69853 | 69993 | + | NZ_CP034930.1 | Apibacter raozihei |
5 | 433990 | 434106 | + | NC_002163.1 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
6 | 1319986 | 1320135 | + | NZ_CP013002.1 | Caulobacter henricii |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00009.29 | 0.67 | 4 | 286.5 | same-strand | Elongation factor Tu GTP binding domain |
2 | PF03143.19 | 0.67 | 4 | 286.5 | same-strand | Elongation factor Tu C-terminal domain |
3 | PF03144.27 | 0.67 | 4 | 286.5 | same-strand | Elongation factor Tu domain 2 |
4 | PF01926.25 | 0.67 | 4 | 286.5 | same-strand | 50S ribosome-binding GTPase |