Protein name |
EXP02712 |
NCBI Accession ID |
|
Organism |
Ruminococcus,Tyzzerella,Eisenbergiella,Clostridium,Blautia |
Left |
|
Right |
|
Strand |
|
Nucleotide Sequence |
ATGCAGAAGAAAAAAAGAGCTTCGGAGAAAGTAAAAAAAGCAGTTGTCAAATTATCAAGAAAAGTTGCAGAAATGGAAGCAAATACAACATGTACGTTCACTTTTTATCAACCGAAAGAAGTTGAAAGTGTTAAGAAGTTGCGGAAGTTTTGA |
Sequence |
MQKKKRASEKVKKAVVKLSRKVAEMEANTTCTFTFYQPKEVESVKKLRKF |
Source of smORF |
Metagenomic Ribo-seq |
Function |
The ORF matches to the profile of cl27940. Profile Description: Staphylococcal AgrD protein. Members of this family of short peptides are precursors to thiolactone (unless Cys is replaced by Ser) cyclic autoinducer peptides, used in quorum-sensing systems in Gram-positive bacteria. The best characterized is the AgrD precursor, processed by the AgrB protein. Nearby proteins regularly encountered include a histidine kinase and a response regulator. This model is related to pfam05931 but is newer and currently broader in scope. |
Pubmed ID |
32601270
|
Domain |
CDD:391800 |
Functional Category |
Conserved domain based functional assignment |
Uniprot ID |
|
ORF Length (Amino Acid) |
50 |