Result : EXP02709
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02709 |
| NCBI Accession ID | |
| Organism | Fusobacterium |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGATACAATTAAATCAAATAAAGATAATTAAAAAACTAAAAAAAGAATATTTTTGGAGTAGAAGTTTTTTAGTGTTAAGTGTTGGTGGAGCAAGTATAGAAGTTATTAAAAAATATATTCAAGGACAAGGAGGAAAAAATGAAAATAGTTAA |
| Sequence | MIQLNQIKIIKKLKKEYFWSRSFLVLSVGGASIEVIKKYIQGQGGKNENS |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 50 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1248650 | 1248823 | + | NZ_CP024955.1 | Kyrpidia spormannii |
| 2 | 1610329 | 1610472 | + | NZ_AP019827.1 | Leptotrichia shahii |
| 3 | 5850835 | 5850993 | - | NC_016641.1 | Paenibacillus terrae HPL-003 |
| 4 | 29284 | 29439 | + | NC_014749.1 | Calditerrivibrio nitroreducens DSM 19672 |
| 5 | 533252 | 533398 | + | NZ_CP018061.1 | Enterococcus mundtii |
| 6 | 1357963 | 1358136 | + | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
| 7 | 168854 | 168997 | - | NZ_CP013213.1 | Erysipelothrix larvae |
| 8 | 1187527 | 1187676 | + | NZ_CP012362.1 | Oblitimonas alkaliphila |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP024955.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01385.21 | 0.75 | 6 | 7.0 | same-strand | Probable transposase |
| 2 | PF07282.13 | 0.75 | 6 | 17 | same-strand | Putative transposase DNA-binding domain |
++ More..