Result : EXP02702
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02702 |
| NCBI Accession ID | |
| Organism | Roseburia |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGTATCTTTCATGTAAAATTCTATTTGCTGACGTAAGAAAGCGAAATGCCCAGTTAGCTCAGTTGGTAGAGCAGAGGACTGAAAATCCTCGTGTCTCTGGTTCGATTCCGGAACTGGGCATTGTGCGGGTGTAG |
| Sequence | MYLSCKILFADVRKRNAQLAQLVEQRTENPRVSGSIPELGIVRV |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 44 |
++ More..
| Conservation Analysis |
No. of Species: 17
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 795637 | 795795 | + | NZ_LR134365.1 | Cardiobacterium hominis |
| 2 | 1412810 | 1412947 | + | NZ_CP030918.1 | Paracoccus suum |
| 3 | 2607005 | 2607136 | + | NC_008260.1 | Alcanivorax borkumensis SK2 |
| 4 | 1021094 | 1021207 | + | NZ_CP018796.1 | Lentilactobacillus parabuchneri |
| 5 | 1042945 | 1043058 | - | NZ_CP029971.1 | Lentilactobacillus kefiri |
| 6 | 1868823 | 1868954 | + | NZ_CP020612.1 | Paracoccus contaminans |
| 7 | 2253786 | 2253920 | + | NZ_CP041783.1 | Shewanella donghaensis |
| 8 | 1488863 | 1488988 | + | NC_016027.1 | Komagataeibacter medellinensis NBRC 3288 |
| 9 | 2017565 | 2017714 | + | NZ_AP019657.1 | Vibrio ponticus |
| 10 | 2501186 | 2501308 | - | NZ_CP026364.1 | Proteus hauseri |
| 11 | 349038 | 349187 | + | NZ_CP015749.1 | Pectobacterium parmentieri |
| 12 | 3697281 | 3697403 | + | NZ_CP038853.1 | Pantoea vagans |
| 13 | 372781 | 372903 | - | NZ_CP034148.1 | Pantoea agglomerans |
| 14 | 598941 | 599072 | - | NZ_LR134510.1 | Actinobacillus delphinicola |
| 15 | 3706621 | 3706743 | + | NZ_CP045720.1 | Pantoea eucalypti |
| 16 | 1407688 | 1407831 | + | NZ_CP049889.1 | Jeotgalibaca porci |
| 17 | 2320009 | 2320143 | + | NZ_CP009220.1 | Corynebacterium deserti GIMN1.010 |
++ More..