Result : EXP02698
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02698 |
| NCBI Accession ID | |
| Organism | Methanobrevibacter |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGTCAGATGAAGATTTAGCTGAAAATATTGAAACTGTTCTTACAGTCTTAGACCGCCATTTAGATAAAGGAAGAAATCAAATTAAATCCATGTTTATTAAAACAACTATGGGTCCAATAGTGAGGGTGATCTAA |
| Sequence | MSDEDLAENIETVLTVLDRHLDKGRNQIKSMFIKTTMGPIVRVI |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 44 |
++ More..
| Conservation Analysis |
No. of Species: 56
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 603289 | 603423 | - | NC_009515.1 | Methanobrevibacter smithii ATCC 35061 |
| 2 | 1035033 | 1035167 | - | NZ_AP019779.1 | Methanobrevibacter arboriphilus |
| 3 | 191267 | 191401 | + | NZ_CP014265.1 | Methanobrevibacter olleyae |
| 4 | 671233 | 671367 | + | NC_013790.1 | Methanobrevibacter ruminantium M1 |
| 5 | 258433 | 258567 | + | NC_014408.1 | Methanothermobacter marburgensis str. Marburg |
| 6 | 1538524 | 1538658 | + | NC_000916.1 | Methanothermobacter thermautotrophicus str. Delta H |
| 7 | 2283512 | 2283646 | + | NC_015216.1 | Methanobacterium lacus |
| 8 | 416256 | 416390 | - | NZ_LT607756.1 | Methanobacterium congolense |
| 9 | 559528 | 559662 | - | NZ_LN734822.1 | Methanobacterium formicicum |
| 10 | 49968 | 50102 | - | NZ_CP017768.1 | Methanobacterium subterraneum |
| 11 | 436275 | 436409 | - | NC_015574.1 | Methanobacterium paludis |
| 12 | 263909 | 264046 | + | NZ_CP006965.1 | Thermococcus paralvinellae |
| 13 | 1329902 | 1330039 | + | NZ_CP010835.1 | Pyrococcus kukulkanii |
| 14 | 60762 | 60899 | - | NZ_LN999010.1 | Thermococcus chitonophagus |
| 15 | 1622517 | 1622654 | + | NC_015680.1 | Pyrococcus yayanosii CH1 |
| 16 | 1431331 | 1431465 | - | NZ_LR698975.1 | Methanosphaera stadtmanae |
| 17 | 1737907 | 1738044 | - | NC_000961.1 | Pyrococcus horikoshii OT3 |
| 18 | 1764520 | 1764657 | - | NC_000868.1 | Pyrococcus abyssi GE5 |
| 19 | 153650 | 153790 | + | NC_014804.1 | Thermococcus barophilus MP |
| 20 | 484551 | 484688 | - | NC_022084.1 | Thermococcus litoralis DSM 5473 |
| 21 | 368318 | 368455 | + | NC_012883.1 | Thermococcus sibiricus MM 739 |
| 22 | 144951 | 145085 | + | NC_014658.1 | Methanothermus fervidus DSM 2088 |
| 23 | 1242950 | 1243087 | - | NC_006624.1 | Thermococcus kodakarensis KOD1 |
| 24 | 1809028 | 1809165 | + | NZ_CP023154.1 | Pyrococcus furiosus DSM 3638 |
| 25 | 1492285 | 1492422 | + | NZ_CP014750.1 | Thermococcus peptonophilus |
| 26 | 473544 | 473681 | + | NC_012804.1 | Thermococcus gammatolerans EJ3 |
| 27 | 1390935 | 1391072 | + | NZ_CP014855.1 | Thermococcus gorgonarius |
| 28 | 1133278 | 1133415 | + | NZ_CP007140.1 | Thermococcus guaymasensis DSM 11113 |
| 29 | 367128 | 367265 | + | NC_018015.1 | Thermococcus cleftensis |
| 30 | 799880 | 800017 | + | NZ_LT900021.1 | Thermococcus henrietii |
| 31 | 31342 | 31479 | - | NZ_CP007264.1 | Thermococcus nautili |
| 32 | 1042862 | 1042999 | + | NZ_CP008887.1 | Thermococcus eurythermalis |
| 33 | 1367244 | 1367381 | - | NZ_CP015520.1 | Thermococcus piezophilus |
| 34 | 386593 | 386730 | - | NZ_CP015101.1 | Thermococcus barossii |
| 35 | 156860 | 156997 | + | NC_011529.1 | Thermococcus onnurineus NA1 |
| 36 | 1112048 | 1112185 | - | NZ_CP015103.1 | Thermococcus siculi |
| 37 | 623937 | 624074 | - | NZ_LR881183.1 | Thermococcus camini |
| 38 | 774456 | 774593 | + | NZ_CP040846.1 | Thermococcus indicus |
| 39 | 806488 | 806625 | + | NZ_CP015106.1 | Thermococcus radiotolerans |
| 40 | 857747 | 857884 | + | NZ_CP015102.1 | Thermococcus pacificus |
| 41 | 386698 | 386835 | + | NZ_CP006019.1 | Palaeococcus pacificus DY20341 |
| 42 | 1837733 | 1837870 | - | NZ_CP014862.1 | Thermococcus profundus |
| 43 | 4034864 | 4034998 | - | NZ_CP009530.1 | Methanosarcina barkeri 227 |
| 44 | 1524066 | 1524200 | - | NC_008553.1 | Methanothrix thermoacetophila PT |
| 45 | 1815373 | 1815510 | - | NZ_CP014854.1 | Thermococcus celer Vu 13 = JCM 8558 |
| 46 | 1565296 | 1565430 | + | NZ_CP032683.1 | Methanosarcina flavescens |
| 47 | 1934651 | 1934785 | + | NZ_CP009501.1 | Methanosarcina thermophila TM-1 |
| 48 | 4112390 | 4112524 | - | NZ_CP009520.1 | Methanosarcina vacuolata Z-761 |
| 49 | 5196440 | 5196574 | + | NC_003552.1 | Methanosarcina acetivorans C2A |
| 50 | 3624960 | 3625094 | + | NZ_CP009515.1 | Methanosarcina lacustris Z-7289 |
| 51 | 2475512 | 2475646 | - | NC_015416.1 | Methanothrix soehngenii GP6 |
| 52 | 2043285 | 2043419 | + | NC_007955.1 | Methanococcoides burtonii DSM 6242 |
| 53 | 761126 | 761263 | - | NC_007796.1 | Methanospirillum hungatei JF-1 |
| 54 | 524845 | 524979 | + | NZ_AP019781.1 | Methanoculleus chikugoensis |
| 55 | 2313248 | 2313382 | - | NC_019977.1 | Methanomethylovorans hollandica DSM 15978 |
| 56 | 397068 | 397202 | + | NC_009051.1 | Methanoculleus marisnigri JR1 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP019779.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00428.21 | 1.0 | 56 | 1063.5 | same-strand | 60s Acidic ribosomal protein |
| 2 | PF00466.22 | 1.0 | 56 | 4.0 | same-strand | Ribosomal protein L10 |
| 3 | PF17777.3 | 1.0 | 56 | 4.0 | same-strand | Insertion domain in 60S ribosomal protein L10P |
| 4 | PF03946.16 | 0.96 | 54 | 598.5 | same-strand | Ribosomal protein L11, N-terminal domain |
| 5 | PF00298.21 | 0.96 | 54 | 598.5 | same-strand | Ribosomal protein L11, RNA binding domain |
| 6 | PF03439.15 | 0.96 | 54 | 1121.0 | same-strand | Early transcription elongation factor of RNA pol II, NGN section |
| 7 | PF00467.31 | 0.96 | 54 | 1121.0 | same-strand | KOW motif |
| 8 | PF00091.27 | 0.91 | 51 | 1890 | same-strand | Tubulin/FtsZ family, GTPase domain |
| 9 | PF12327.10 | 0.91 | 51 | 1890 | same-strand | FtsZ family, C-terminal domain |
| 10 | PF00584.22 | 0.66 | 37 | 1594 | same-strand | SecE/Sec61-gamma subunits of protein translocation complex |
++ More..