Result : B6EIU9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0352 protein VSAL_I1058 |
| NCBI Accession ID | FM178379.1 |
| Organism | Aliivibrio salmonicida (strain LFI1238) (Vibrio salmonicida (strain LFI1238)) |
| Left | 1151258 |
| Right | 1151485 |
| Strand | - |
| Nucleotide Sequence | ATGGCTATTACTTCGAAATACAGCAACAAACAAATTGAACAAATGTTAACAGAGATGGTCGATGTATTAGATAAACATCGTGCTCCTGCAGATCTATCTCTAATGTTGGTTGGTAACATTGCGACTAATGTACTAAACCAAGAAGTGCCAGCAGAACAGCGTAAAATTATCGCTGAAAAATTTGCTCAAGCGCTGCTTAGCTCATTAGATATTCCAAAAACTCACTAA |
| Sequence | MAITSKYSNKQIEQMLTEMVDVLDKHRAPADLSLMLVGNIATNVLNQEVPAEQRKIIAEKFAQALLSSLDIPKTH |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl01175. Profile Description: Protein of unknown function (DUF1414). hypothetical protein; Provisional |
| Pubmed ID | 19099551 |
| Domain | CDD:412779 |
| Functional Category | Others |
| Uniprot ID | B6EIU9 |
| ORF Length (Amino Acid) | 75 |
++ More..
| Conservation Analysis |
No. of Species: 102
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1151258 | 1151485 | - | NC_011312.1 | Aliivibrio salmonicida LFI1238 |
| 2 | 1211503 | 1211730 | - | NZ_CP044069.1 | Vibrio vulnificus |
| 3 | 2905218 | 2905445 | - | NZ_CP019959.1 | Vibrio owensii |
| 4 | 2136706 | 2136933 | + | NZ_CP032093.1 | Vibrio alfacsensis |
| 5 | 3327647 | 3327874 | - | NZ_CP025792.1 | Vibrio jasicida 090810c |
| 6 | 2243428 | 2243655 | + | NZ_CP030788.1 | Vibrio campbellii |
| 7 | 1462105 | 1462332 | - | NC_013456.1 | Vibrio antiquarius |
| 8 | 1033634 | 1033861 | - | NZ_CP031781.1 | Vibrio parahaemolyticus |
| 9 | 2771654 | 2771881 | + | NZ_CP009467.1 | Vibrio harveyi |
| 10 | 827892 | 828119 | - | NZ_CP018312.1 | Vibrio rotiferianus |
| 11 | 13750 | 13965 | - | NZ_CP046793.1 | Vibrio metschnikovii |
| 12 | 2359636 | 2359854 | + | NZ_CP071325.1 | Photobacterium ganghwense |
| 13 | 671407 | 671634 | - | NZ_CP009977.1 | Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM 759 |
| 14 | 1439209 | 1439427 | - | NZ_CP005974.1 | Photobacterium gaetbulicola Gung47 |
| 15 | 1725410 | 1725625 | + | NZ_CP035688.1 | Vibrio metoecus |
| 16 | 959452 | 959667 | - | NZ_AP014635.1 | Vibrio tritonius |
| 17 | 2327078 | 2327302 | + | NZ_CP009354.1 | Vibrio tubiashii ATCC 19109 |
| 18 | 2526370 | 2526594 | + | NZ_CP046268.1 | Vibrio spartinae |
| 19 | 2192771 | 2192998 | + | NZ_LT960611.1 | Vibrio tapetis subsp. tapetis |
| 20 | 2057203 | 2057418 | + | NZ_AP014524.1 | Vibrio cholerae MS6 |
| 21 | 441442 | 441669 | + | NZ_CP065150.1 | Vibrio kanaloae |
| 22 | 2757045 | 2757260 | + | NZ_CP040990.1 | Vibrio furnissii |
| 23 | 962590 | 962805 | - | NZ_CP033078.1 | Vibrio zhugei |
| 24 | 1965927 | 1966151 | + | NZ_AP019657.1 | Vibrio ponticus |
| 25 | 2160834 | 2161058 | + | NZ_CP047475.1 | Vibrio astriarenae |
| 26 | 990072 | 990299 | - | NZ_CP039700.1 | Vibrio cyclitrophicus |
| 27 | 572269 | 572484 | - | NZ_CP014035.2 | Vibrio fluvialis |
| 28 | 1591312 | 1591527 | + | NZ_AP018689.1 | Vibrio aphrogenes |
| 29 | 977871 | 978098 | - | NC_011753.2 | Vibrio atlanticus |
| 30 | 2083135 | 2083359 | + | NZ_CP016414.1 | Vibrio scophthalmi |
| 31 | 879060 | 879284 | - | NZ_AP019651.1 | Vibrio taketomensis |
| 32 | 1925454 | 1925678 | + | NZ_CP022741.1 | Vibrio qinghaiensis |
| 33 | 1056546 | 1056770 | - | NZ_CP045350.1 | Vibrio aquimaris |
| 34 | 1059453 | 1059668 | - | NZ_AP018685.1 | Vibrio rumoiensis |
| 35 | 1959539 | 1959757 | + | NZ_CP040021.1 | Salinivibrio kushneri |
| 36 | 3089917 | 3090135 | + | NC_016901.1 | Shewanella baltica OS678 |
| 37 | 4703172 | 4703399 | + | NZ_CP040428.1 | Jejubacter calystegiae |
| 38 | 3030519 | 3030737 | + | NC_010334.1 | Shewanella halifaxensis HAW-EB4 |
| 39 | 2677269 | 2677496 | - | NZ_CP023536.1 | Providencia alcalifaciens |
| 40 | 2437765 | 2437992 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 41 | 2307374 | 2307559 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 42 | 1583852 | 1584079 | - | NZ_LR134376.1 | Aeromonas encheleia |
| 43 | 2365686 | 2365904 | - | NC_011566.1 | Shewanella piezotolerans WP3 |
| 44 | 4523742 | 4523969 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 45 | 2329115 | 2329342 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 46 | 2145353 | 2145568 | - | NC_009901.1 | Shewanella pealeana ATCC 700345 |
| 47 | 2022612 | 2022830 | - | NZ_CP022358.1 | Shewanella bicestrii |
| 48 | 1526927 | 1527112 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
| 49 | 1256647 | 1256865 | - | NZ_CP070624.1 | Photobacterium damselae subsp. damselae |
| 50 | 2978727 | 2978939 | + | NC_008345.1 | Shewanella frigidimarina NCIMB 400 |
| 51 | 1851356 | 1851583 | - | NZ_LS483422.1 | Providencia heimbachae |
| 52 | 2273836 | 2274054 | - | NZ_CP014056.2 | Grimontia hollisae |
| 53 | 2765865 | 2766077 | + | NC_007954.1 | Shewanella denitrificans OS217 |
| 54 | 4776427 | 4776654 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 55 | 1751120 | 1751347 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 56 | 3426812 | 3427039 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 57 | 1585841 | 1586068 | - | NZ_CP035129.1 | Kosakonia cowanii |
| 58 | 1382278 | 1382505 | - | NZ_LR134201.1 | Cedecea lapagei |
| 59 | 1419329 | 1419556 | - | NZ_CP023525.1 | Cedecea neteri |
| 60 | 2830859 | 2831044 | + | NZ_LR134340.1 | Escherichia marmotae |
| 61 | 2284171 | 2284356 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 62 | 2293302 | 2293487 | + | NZ_AP014857.1 | Escherichia albertii |
| 63 | 3019236 | 3019421 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 64 | 411315 | 411530 | + | NZ_CP036200.1 | Shewanella maritima |
| 65 | 1961067 | 1961285 | - | NZ_CP020472.1 | Shewanella japonica |
| 66 | 3114085 | 3114312 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 67 | 2774253 | 2774438 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 68 | 1828353 | 1828580 | + | NZ_CP051883.1 | Aeromonas salmonicida |
| 69 | 2039378 | 2039590 | + | NZ_CP032090.1 | Pseudoalteromonas donghaensis |
| 70 | 1497522 | 1497749 | - | NZ_LR134475.1 | Klebsiella aerogenes |
| 71 | 3174708 | 3174935 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 72 | 3206190 | 3206417 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
| 73 | 3167153 | 3167380 | + | NC_015968.1 | Enterobacter soli |
| 74 | 3313171 | 3313356 | + | NZ_CP009756.1 | Enterobacter cloacae |
| 75 | 2457484 | 2457711 | + | NZ_CP017279.1 | Enterobacter ludwigii |
| 76 | 309917 | 310102 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
| 77 | 2725624 | 2725839 | + | NZ_CP022272.1 | Shewanella marisflavi |
| 78 | 3401775 | 3401990 | + | NC_010506.1 | Shewanella woodyi ATCC 51908 |
| 79 | 1999915 | 2000142 | + | NZ_CP031123.2 | Providencia huaxiensis |
| 80 | 1282292 | 1282519 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 81 | 1664907 | 1665119 | - | NZ_CP041036.1 | Shewanella polaris |
| 82 | 1992080 | 1992292 | - | NZ_CP034015.1 | Shewanella livingstonensis |
| 83 | 1697292 | 1697507 | - | NC_009092.1 | Shewanella loihica PV-4 |
| 84 | 1957224 | 1957451 | - | NZ_CP048796.1 | Providencia vermicola |
| 85 | 530163 | 530390 | - | NZ_CP027107.1 | Cronobacter sakazakii |
| 86 | 1251230 | 1251457 | - | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 87 | 2898338 | 2898565 | + | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 88 | 1055669 | 1055896 | - | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 89 | 944569 | 944754 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 90 | 3158075 | 3158302 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
| 91 | 4080283 | 4080510 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 92 | 3478923 | 3479150 | + | NZ_CP043318.1 | Enterobacter chengduensis |
| 93 | 2079146 | 2079358 | + | NZ_CP046378.1 | Shewanella algae |
| 94 | 2857686 | 2857913 | + | NZ_CP012621.1 | Zobellella denitrificans |
| 95 | 1378921 | 1379139 | - | NZ_CP020373.1 | Shewanella khirikhana |
| 96 | 2181518 | 2181733 | - | NC_009831.1 | Shewanella sediminis HAW-EB3 |
| 97 | 4837 | 5064 | - | NZ_CP021376.1 | Oceanisphaera avium |
| 98 | 1466159 | 1466386 | + | NZ_CP044060.1 | Aeromonas veronii |
| 99 | 1715341 | 1715568 | + | NZ_CP065745.1 | Aeromonas allosaccharophila |
| 100 | 2013875 | 2014090 | - | NC_014012.1 | Shewanella violacea DSS12 |
| 101 | 467183 | 467398 | - | NZ_CP014782.1 | Shewanella psychrophila |
| 102 | 323130 | 323357 | + | NZ_CP053416.1 | Salmonella bongori |
| 103 | 1795851 | 1796078 | - | NC_014541.1 | Ferrimonas balearica DSM 9799 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_011312.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF11893.10 | 0.99 | 101 | 27.0 | same-strand | Domain of unknown function (DUF3413) |
| 2 | PF00884.25 | 0.92 | 94 | 28 | same-strand | Sulfatase |
| 3 | PF04245.15 | 0.99 | 101 | 133.0 | opposite-strand | 37-kD nucleoid-associated bacterial protein |
++ More..