Result : EXP02658
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02658 |
| NCBI Accession ID | |
| Organism | Bacteroides |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGTTTGGAGATTCAGAAGTTTCTACTACCTTTGCAGCCGCAAACACGGGAGTAGCTCAGTTGGTAGAGCACCGGTCTCCAAAACCGGGTGTCGGGAGTTCGAGCCTCTCCTCCCGTGCAAAAAAGATTATTCAATGCCACGCCATTGGATAA |
| Sequence | MFGDSEVSTTFAAANTGVAQLVEHRSPKPGVGSSSLSSRAKKIIQCHAIG |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 50 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 6092120 | 6092263 | - | NZ_CP012938.1 | Bacteroides ovatus |
| 2 | 908145 | 908288 | - | NZ_CP015401.2 | Bacteroides caecimuris |
| 3 | 3066519 | 3066683 | - | NC_014933.1 | Bacteroides helcogenes P 36-108 |
| 4 | 2921083 | 2921208 | + | NC_015164.1 | Phocaeicola salanitronis DSM 18170 |
| 5 | 664985 | 665113 | + | NZ_AP012547.1 | Sulfuritalea hydrogenivorans sk43H |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_014933.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01926.25 | 0.6 | 3 | 53 | same-strand | 50S ribosome-binding GTPase |
++ More..