Protein Information |
Information Type | Description |
---|---|
Protein name | EXP02658 |
NCBI Accession ID | |
Organism | Bacteroides |
Left | |
Right | |
Strand | |
Nucleotide Sequence | ATGTTTGGAGATTCAGAAGTTTCTACTACCTTTGCAGCCGCAAACACGGGAGTAGCTCAGTTGGTAGAGCACCGGTCTCCAAAACCGGGTGTCGGGAGTTCGAGCCTCTCCTCCCGTGCAAAAAAGATTATTCAATGCCACGCCATTGGATAA |
Sequence | MFGDSEVSTTFAAANTGVAQLVEHRSPKPGVGSSSLSSRAKKIIQCHAIG |
Source of smORF | Metagenomic Ribo-seq |
Function | |
Pubmed ID | 32601270 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 50 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 6092120 | 6092263 | - | NZ_CP012938.1 | Bacteroides ovatus |
2 | 908145 | 908288 | - | NZ_CP015401.2 | Bacteroides caecimuris |
3 | 3066519 | 3066683 | - | NC_014933.1 | Bacteroides helcogenes P 36-108 |
4 | 2921083 | 2921208 | + | NC_015164.1 | Phocaeicola salanitronis DSM 18170 |
5 | 664985 | 665113 | + | NZ_AP012547.1 | Sulfuritalea hydrogenivorans sk43H |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01926.25 | 0.6 | 3 | 53 | same-strand | 50S ribosome-binding GTPase |