Result : EXP02655
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02655 |
| NCBI Accession ID | |
| Organism | Alistipes |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGGAGGATATTGACAAAAACGAGGTTTCAGACGAAGGCATCTCTGATGACGAAGATCTTATGATGCGGGAGGTTGTCCAGGGTGACGCAGATCTTTTCTTTTTACACCATTACCTCTCGGAGGTTTCCGGAAATTGA |
| Sequence | MEDIDKNEVSDEGISDDEDLMMREVVQGDADLFFLHHYLSEVSGN |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 45 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1556212 | 1556361 | + | NZ_LR027382.1 | Alistipes megaguti |
| 2 | 1828251 | 1828400 | + | NZ_AP019736.1 | Alistipes dispar |
| 3 | 2000808 | 2000957 | + | NC_018011.1 | Alistipes finegoldii DSM 17242 |
| 4 | 1634051 | 1634191 | + | NZ_AP023049.1 | Alistipes indistinctus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR027382.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01545.23 | 0.75 | 3 | 890 | same-strand | Cation efflux family |
| 2 | PF16916.7 | 0.75 | 3 | 890 | same-strand | Dimerisation domain of Zinc Transporter |
| 3 | PF04542.16 | 1.0 | 4 | 65.0 | same-strand | Sigma-70 region 2 |
| 4 | PF07638.13 | 1.0 | 4 | 65.0 | same-strand | ECF sigma factor |
| 5 | PF04545.18 | 1.0 | 4 | 65.0 | same-strand | Sigma-70, region 4 |
| 6 | PF03729.15 | 0.75 | 3 | 1145 | opposite-strand | Short repeat of unknown function (DUF308) |
++ More..