Result : B5Z8W5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L23 |
| NCBI Accession ID | CP001173.1 |
| Organism | Helicobacter pylori (strain G27) |
| Left | 1371418 |
| Right | 1371699 |
| Strand | - |
| Nucleotide Sequence | ATGGCAGACATCATGGATATAAAGTCAATTCTTTACACTGAAAAGTCATTAGGATTGCAAGAAAAAGGTGTTTTAGTGGTCCAAACGGCTCAAAATGTAACCAAAAACCAGCTCAAAGAAGTGTTTAAAACTTACTTTGGCTTTGAGCCTTTGAAAATCAATTCTTTGAAACAAGAGGGTAAGGTGAAACGCTTTAGAGGGAAGCTTGGACAAAGAAAGTCGTTTAAGAAATTTTATGTGAAAGTTCCAGAGGGCGCTAGCATTGCCGCCCTTGGTGCGTAG |
| Sequence | MADIMDIKSILYTEKSLGLQEKGVLVVQTAQNVTKNQLKEVFKTYFGFEPLKINSLKQEGKVKRFRGKLGQRKSFKKFYVKVPEGASIAALGA |
| Source of smORF | Swiss-Prot |
| Function | One of the early assembly proteins it binds 23S rRNA. One of the proteins that surrounds the polypeptide exit tunnel on the outside of the ribosome. Forms the main docking site for trigger factor binding to the ribosome. {ECO:0000255|HAMAP-Rule:MF_01369}. |
| Pubmed ID | 18952803 |
| Domain | CDD:412311 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | B5Z8W5 |
| ORF Length (Amino Acid) | 93 |
++ More..
| Conservation Analysis |
No. of Species: 83
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1365436 | 1365717 | - | NC_017379.1 | Helicobacter pylori Puno135 |
| 2 | 845749 | 846030 | - | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
| 3 | 126168 | 126449 | + | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
| 4 | 1331287 | 1331568 | + | NC_004917.1 | Helicobacter hepaticus ATCC 51449 |
| 5 | 1176316 | 1176597 | - | NZ_LS483446.1 | Helicobacter mustelae |
| 6 | 1271774 | 1272055 | - | NZ_LN907858.1 | Helicobacter typhlonius |
| 7 | 582984 | 583265 | + | NZ_AP018676.1 | Helicobacter cinaedi |
| 8 | 658412 | 658693 | + | NZ_CP014991.1 | Helicobacter himalayensis |
| 9 | 1356310 | 1356591 | - | NZ_AP023212.1 | Hydrogenimonas urashimensis |
| 10 | 183023 | 183304 | + | NZ_CP012196.1 | Campylobacter gracilis |
| 11 | 1305280 | 1305561 | - | NC_014810.2 | Helicobacter felis ATCC 49179 |
| 12 | 1615275 | 1615556 | - | NC_005090.1 | Wolinella succinogenes DSM 1740 |
| 13 | 608361 | 608642 | + | NZ_CP032099.1 | Aliarcobacter skirrowii CCUG 10374 |
| 14 | 569574 | 569855 | + | NZ_CP036246.2 | [Arcobacter] porcinus |
| 15 | 1484664 | 1484945 | - | NZ_CP053837.1 | Aliarcobacter faecis |
| 16 | 1615599 | 1615880 | - | NZ_CP054051.1 | Aliarcobacter cibarius |
| 17 | 724877 | 725158 | + | NC_017187.1 | Aliarcobacter butzleri ED-1 |
| 18 | 156112 | 156393 | + | NZ_AP022847.1 | Nitrosophilus alvini |
| 19 | 723887 | 724168 | + | NZ_CP031367.1 | Aliarcobacter trophiarum LMG 25534 |
| 20 | 949434 | 949715 | + | NZ_CP031219.1 | Malaciobacter mytili LMG 24559 |
| 21 | 637150 | 637431 | + | NZ_CP032823.1 | Aliarcobacter cryaerophilus ATCC 43158 |
| 22 | 811793 | 812074 | + | NZ_CP030944.1 | Arcobacter aquimarinus |
| 23 | 866576 | 866857 | + | NZ_CP053833.1 | Arcobacter cloacae |
| 24 | 65054 | 65335 | + | NZ_CP021886.1 | Helicobacter apodemus |
| 25 | 947239 | 947520 | + | NZ_CP053836.1 | Halarcobacter ebronensis |
| 26 | 972494 | 972775 | + | NZ_CP042652.1 | Pseudoarcobacter acticola |
| 27 | 935345 | 935626 | + | NZ_CP032100.1 | Arcobacter suis CECT 7833 |
| 28 | 1056632 | 1056913 | + | NZ_CP053840.1 | Arcobacter venerupis |
| 29 | 929082 | 929363 | + | NZ_CP019070.1 | Poseidonibacter parvus |
| 30 | 908697 | 908978 | + | NZ_CP053835.1 | Arcobacter defluvii |
| 31 | 1396953 | 1397234 | - | NZ_CP063087.1 | Helicobacter winghamensis |
| 32 | 1589260 | 1589541 | - | NZ_CP027432.2 | Caminibacter pacificus |
| 33 | 1532768 | 1533049 | - | NC_012115.1 | Nautilia profundicola AmH |
| 34 | 193989 | 194270 | + | NC_014762.1 | Sulfuricurvum kujiense DSM 16994 |
| 35 | 1085082 | 1085363 | + | NC_014166.1 | Arcobacter nitrofigilis DSM 7299 |
| 36 | 691714 | 691995 | + | NZ_CP063079.1 | Campylobacter peloridis |
| 37 | 55380 | 55661 | + | NZ_CP007774.1 | Campylobacter volucris LMG 24379 |
| 38 | 59032 | 59313 | + | NZ_CP007770.1 | Campylobacter insulaenigrae NCTC 12927 |
| 39 | 841415 | 841696 | + | NZ_CP032098.1 | Malaciobacter molluscorum LMG 25693 |
| 40 | 29554 | 29835 | + | NZ_CP053825.1 | Campylobacter armoricus |
| 41 | 67533 | 67814 | + | NZ_CP053848.1 | Campylobacter ornithocola |
| 42 | 886408 | 886689 | + | NZ_CP032097.1 | Arcobacter ellisii |
| 43 | 342791 | 343072 | + | NZ_CP040463.1 | Caminibacter mediatlanticus TB-2 |
| 44 | 784261 | 784542 | + | NZ_CP035928.1 | Malaciobacter pacificus |
| 45 | 972218 | 972499 | + | NZ_CP042812.1 | Malaciobacter canalis |
| 46 | 943217 | 943498 | + | NZ_CP032101.1 | Malaciobacter marinus |
| 47 | 58409 | 58690 | + | NC_012039.1 | Campylobacter lari RM2100 |
| 48 | 60792 | 61073 | + | NZ_CP007773.1 | Campylobacter subantarcticus LMG 24377 |
| 49 | 875042 | 875323 | + | NZ_CP031218.1 | Malaciobacter halophilus |
| 50 | 1608301 | 1608582 | + | NZ_CP022347.1 | Campylobacter avium LMG 24591 |
| 51 | 1785584 | 1785865 | - | NZ_CP053841.1 | Campylobacter blaseri |
| 52 | 1835061 | 1835342 | - | NZ_CP053826.1 | Campylobacter curvus |
| 53 | 1870417 | 1870698 | - | NZ_CP035946.1 | Campylobacter canadensis |
| 54 | 89051 | 89332 | + | NZ_CP010995.1 | Campylobacter iguaniorum |
| 55 | 65585 | 65866 | + | NZ_CP012543.1 | Campylobacter rectus |
| 56 | 1530023 | 1530304 | - | NZ_CP015578.1 | Campylobacter lanienae NCTC 13004 |
| 57 | 1593639 | 1593920 | - | NZ_CP053842.1 | Campylobacter corcagiensis |
| 58 | 35071 | 35352 | + | NZ_CP059443.1 | Campylobacter fetus |
| 59 | 100927 | 101208 | + | NZ_CP053828.1 | Campylobacter hyointestinalis subsp. lawsonii |
| 60 | 2024088 | 2024369 | - | NZ_CP012544.1 | Campylobacter showae |
| 61 | 106642 | 106923 | + | NZ_CP012547.1 | Campylobacter pinnipediorum subsp. pinnipediorum |
| 62 | 170632 | 170913 | + | NZ_CP041406.1 | Sulfurimonas paralvinellae |
| 63 | 1853721 | 1854002 | - | NZ_AP022826.1 | Nitrosophilus labii |
| 64 | 212758 | 213039 | + | NC_014506.1 | Sulfurimonas autotrophica DSM 16294 |
| 65 | 1739732 | 1740013 | - | NZ_CP012541.1 | Campylobacter concisus |
| 66 | 1674068 | 1674349 | - | NZ_CP053831.1 | Campylobacter mucosalis |
| 67 | 12384 | 12665 | + | NZ_CP020867.1 | Campylobacter cuniculorum DSM 23162 = LMG 24588 |
| 68 | 1246337 | 1246618 | + | NZ_CP031611.1 | Campylobacter hepaticus |
| 69 | 304901 | 305182 | + | NC_007575.1 | Sulfurimonas denitrificans DSM 1251 |
| 70 | 1579580 | 1579861 | - | NZ_CP053849.1 | Campylobacter upsaliensis RM3940 |
| 71 | 1618909 | 1619190 | - | NC_002163.1 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
| 72 | 102076 | 102357 | + | NC_014935.1 | Nitratifractor salsuginis DSM 16511 |
| 73 | 2136339 | 2136620 | + | NZ_CP011308.1 | Sulfurovum lithotrophicum |
| 74 | 56364 | 56645 | + | NZ_CP020478.1 | Campylobacter helveticus |
| 75 | 152589 | 152870 | + | NZ_CP063164.1 | Sulfurovum indicum |
| 76 | 421314 | 421595 | + | NZ_AP014724.1 | Sulfurospirillum cavolei |
| 77 | 1689582 | 1689863 | - | NZ_CP019684.1 | Campylobacter sputorum bv. paraureolyticus LMG 11764 |
| 78 | 2439853 | 2440134 | - | NZ_CP017111.1 | Sulfurospirillum halorespirans DSM 13726 |
| 79 | 2597390 | 2597671 | - | NZ_CP007201.1 | Sulfurospirillum multivorans DSM 12446 |
| 80 | 2050654 | 2050935 | - | NC_018002.1 | Sulfurospirillum barnesii SES-3 |
| 81 | 1984590 | 1984871 | - | NC_013512.1 | Sulfurospirillum deleyianum DSM 6946 |
| 82 | 672455 | 672736 | + | NZ_CP031217.1 | Halarcobacter bivalviorum |
| 83 | 932839 | 933120 | + | NZ_CP041070.1 | Arcobacter anaerophilus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_017379.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00252.20 | 1.0 | 83 | 2166 | same-strand | Ribosomal protein L16p/L10e |
| 2 | PF00189.22 | 1.0 | 83 | 1462 | same-strand | Ribosomal protein S3, C-terminal domain |
| 3 | PF07650.19 | 1.0 | 83 | 1462 | same-strand | KH domain |
| 4 | PF00237.21 | 1.0 | 83 | 1127 | same-strand | Ribosomal protein L22p/L17e |
| 5 | PF00203.23 | 1.0 | 83 | 848 | same-strand | Ribosomal protein S19 |
| 6 | PF03947.20 | 1.0 | 83 | 10 | same-strand | Ribosomal Proteins L2, C-terminal domain |
| 7 | PF00181.25 | 1.0 | 83 | 10 | same-strand | Ribosomal Proteins L2, RNA binding domain |
| 8 | PF00573.24 | 1.0 | 83 | 2 | same-strand | Ribosomal protein L4/L1 family |
| 9 | PF00338.24 | 1.0 | 83 | 1203 | same-strand | Ribosomal protein S10p/S20e |
++ More..