Result : B5YKI9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | NADH-quinone oxidoreductase subunit K (EC 7.1.1.-) (NADH dehydrogenase I subunit K) (NDH-1 subunit K) |
| NCBI Accession ID | CP001147.1 |
| Organism | Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) |
| Left | 883337 |
| Right | 883639 |
| Strand | + |
| Nucleotide Sequence | ATGATACCTCTTAGCTGGTATTTATTATTGAGCGCTACTTTGTTCAGTATAGGTTTAATTGGTTTTGTAATAAGAAGAGATTTGATTGTAATGCTTATGTGTCTTGAAATAATGTTTAATGCTGTTAATATTGCTTTTGCTTCATTTAGTTATTATAATTCTAATCTTACTGGACAGATTTTTGTTTTATTTTCAATAGCAGTTGCTGCATGTGAAGCTGTTATAGGACTTGCAATTGTTCTCGCTCTTGTTAGAAATACAGGTATCAATCACTCTGATGAGATTGTTAATTTGAGGGGTTAA |
| Sequence | MIPLSWYLLLSATLFSIGLIGFVIRRDLIVMLMCLEIMFNAVNIAFASFSYYNSNLTGQIFVLFSIAVAACEAVIGLAIVLALVRNTGINHSDEIVNLRG |
| Source of smORF | Swiss-Prot |
| Function | NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. {ECO:0000255|HAMAP-Rule:MF_01456}. |
| Pubmed ID | |
| Domain | CDD:412408 |
| Functional Category | Others |
| Uniprot ID | B5YKI9 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 119
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1914974 | 1915276 | - | NZ_AP022873.1 | Dissulfurispira thermophila |
| 2 | 1592549 | 1592851 | + | NZ_CP021255.1 | Desulfobulbus oralis |
| 3 | 2061088 | 2061369 | - | NC_010794.1 | Methylacidiphilum infernorum V4 |
| 4 | 2049498 | 2049779 | - | NZ_CP037899.1 | Methylacidiphilum kamchatkense Kam1 |
| 5 | 1887319 | 1887585 | - | NZ_AP022618.1 | Mycolicibacterium insubricum |
| 6 | 1715366 | 1715668 | - | NC_017094.1 | Leptospirillum ferrooxidans C2-3 |
| 7 | 723722 | 723985 | + | NC_012029.1 | Halorubrum lacusprofundi ATCC 49239 |
| 8 | 3389854 | 3390153 | - | NZ_CP072827.1 | Streptomyces mobaraensis NBRC 13819 = DSM 40847 |
| 9 | 3919915 | 3920214 | + | NZ_CP062008.1 | Mycolicibacterium mucogenicum DSM 44124 |
| 10 | 1422628 | 1422933 | + | NZ_AP012547.1 | Sulfuritalea hydrogenivorans sk43H |
| 11 | 3590006 | 3590269 | - | NZ_CP060404.1 | Streptomyces buecherae |
| 12 | 1441891 | 1442193 | - | NC_019977.1 | Methanomethylovorans hollandica DSM 15978 |
| 13 | 5727891 | 5728235 | - | NZ_CP010429.1 | Spirosoma radiotolerans |
| 14 | 1142128 | 1142430 | + | NZ_CP017921.1 | Methanohalophilus halophilus |
| 15 | 4715099 | 4715362 | - | NZ_CP031455.1 | Streptomyces olivoreticuli subsp. olivoreticuli |
| 16 | 1758108 | 1758452 | + | NZ_CP020105.1 | Spirosoma rigui |
| 17 | 13499 | 13843 | + | NZ_CP053435.1 | Spirosoma taeanense |
| 18 | 246062 | 246406 | - | NZ_CP050063.1 | Spirosoma aureum |
| 19 | 7388901 | 7389158 | - | NZ_CP020104.1 | Spirosoma aerolatum |
| 20 | 2303530 | 2303829 | - | NZ_CP042437.1 | Mucilaginibacter ginsenosidivorax |
| 21 | 2156799 | 2157107 | + | NZ_CP013232.1 | Collimonas fungivorans |
| 22 | 6567639 | 6567983 | - | NZ_CP025096.1 | Spirosoma pollinicola |
| 23 | 1380083 | 1380385 | - | NC_007955.1 | Methanococcoides burtonii DSM 6242 |
| 24 | 4647850 | 4648194 | - | NZ_CP014263.1 | Spirosoma montaniterrae |
| 25 | 1587630 | 1587932 | - | NC_014002.1 | Methanohalophilus mahii DSM 5219 |
| 26 | 1954088 | 1954390 | + | NZ_CP019154.1 | Haloarcula taiwanensis |
| 27 | 428893 | 429198 | + | NZ_CP018799.1 | Mariprofundus aestuarium |
| 28 | 4884278 | 4884607 | + | NZ_AP017313.1 | Mucilaginibacter gotjawali |
| 29 | 2769706 | 2770005 | + | NZ_AP022563.1 | Mycolicibacterium duvalii |
| 30 | 3131563 | 3131862 | + | NZ_CP019893.1 | Natrarchaeobaculum aegyptiacum |
| 31 | 1967989 | 1968291 | + | NC_015948.1 | Haloarcula hispanica ATCC 33960 |
| 32 | 631200 | 631502 | - | NZ_CP073366.1 | Haloarcula sinaiiensis ATCC 33800 |
| 33 | 1295499 | 1295801 | + | NC_006396.1 | Haloarcula marismortui ATCC 43049 |
| 34 | 4082511 | 4082816 | + | NZ_CP025491.2 | Legionella sainthelensi |
| 35 | 2964000 | 2964272 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 36 | 5676715 | 5676978 | + | NZ_AP022579.1 | Mycolicibacterium boenickei |
| 37 | 2610901 | 2611149 | - | NZ_LR134378.1 | Lautropia mirabilis |
| 38 | 2161960 | 2162223 | - | NC_014297.1 | Halalkalicoccus jeotgali B3 |
| 39 | 1782881 | 1783147 | - | NZ_CP011491.1 | Mycolicibacterium vaccae 95051 |
| 40 | 2291647 | 2291946 | - | NZ_AP022570.1 | Mycolicibacterium poriferae |
| 41 | 2376829 | 2377104 | + | NZ_AP017558.1 | Halopenitus persicus |
| 42 | 5814449 | 5814748 | - | NZ_AP022616.1 | Mycolicibacterium phocaicum |
| 43 | 1762625 | 1762924 | - | NZ_LR134356.1 | Mycolicibacterium aurum |
| 44 | 2002123 | 2002422 | - | NC_008726.1 | Mycolicibacterium vanbaalenii PYR-1 |
| 45 | 948572 | 948877 | + | NZ_CP007031.1 | Marichromatium purpuratum 984 |
| 46 | 1837993 | 1838295 | + | NZ_CP048877.1 | Thermosulfuriphilus ammonigenes |
| 47 | 1503638 | 1503937 | + | NZ_AP022577.1 | Mycolicibacterium aubagnense |
| 48 | 1602478 | 1602726 | + | NC_018020.1 | Turneriella parva DSM 21527 |
| 49 | 2005532 | 2005780 | - | NC_013939.1 | Deferribacter desulfuricans SSM1 |
| 50 | 1619580 | 1619882 | - | NC_016024.1 | Chloracidobacterium thermophilum B |
| 51 | 1156954 | 1157259 | + | NZ_AP017372.2 | Halorhodospira halochloris |
| 52 | 3116993 | 3117241 | + | NC_014008.1 | Coraliomargarita akajimensis DSM 45221 |
| 53 | 270791 | 271036 | + | NC_014253.1 | Methanohalobium evestigatum Z-7303 |
| 54 | 9288641 | 9288940 | - | NZ_CP007155.1 | Kutzneria albida DSM 43870 |
| 55 | 3462551 | 3462859 | - | NZ_CP013236.1 | Collimonas pratensis |
| 56 | 7070837 | 7071136 | + | NZ_CP015163.1 | Amycolatopsis albispora |
| 57 | 1789254 | 1789502 | + | NC_011959.1 | Thermomicrobium roseum DSM 5159 |
| 58 | 4275405 | 4275668 | - | NZ_CP023699.1 | Streptomyces kanamyceticus |
| 59 | 5636172 | 5636435 | + | NZ_CP023690.1 | Streptomyces spectabilis |
| 60 | 2351720 | 2351965 | + | NZ_CP053564.1 | Pseudonocardia broussonetiae |
| 61 | 16486 | 16788 | + | NC_013943.1 | Denitrovibrio acetiphilus DSM 12809 |
| 62 | 3709124 | 3709423 | + | NC_016111.1 | Streptomyces cattleya NRRL 8057 = DSM 46488 |
| 63 | 4077639 | 4077938 | - | NZ_CP032427.1 | Streptomyces griseorubiginosus |
| 64 | 1257063 | 1257371 | - | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 65 | 4647198 | 4647461 | + | NZ_CP012382.1 | Streptomyces ambofaciens ATCC 23877 |
| 66 | 6191062 | 6191325 | + | NZ_CP034463.1 | Streptomyces aquilus |
| 67 | 4658979 | 4659242 | + | NZ_CP023703.1 | Streptomyces galilaeus |
| 68 | 4225642 | 4225905 | + | NZ_CP015866.1 | Streptomyces parvulus |
| 69 | 3745998 | 3746261 | - | NZ_CP034687.1 | Streptomyces griseoviridis |
| 70 | 4680682 | 4680981 | - | NZ_CP070326.1 | Streptomyces noursei |
| 71 | 4586346 | 4586645 | + | NC_015564.1 | Hoyosella subflava DQS3-9A1 |
| 72 | 3817889 | 3818188 | - | NZ_CP011340.1 | Streptomyces pristinaespiralis |
| 73 | 5272177 | 5272440 | + | NZ_CP027306.1 | Streptomyces atratus |
| 74 | 3353056 | 3353355 | - | NZ_CP040752.1 | Streptomyces rectiverticillatus |
| 75 | 3685499 | 3685762 | - | NZ_CP032698.1 | Streptomyces hundungensis |
| 76 | 2653174 | 2653503 | + | NZ_CP012643.1 | Rufibacter tibetensis |
| 77 | 2716728 | 2717027 | - | NZ_CP065253.1 | Streptomyces clavuligerus |
| 78 | 2275696 | 2276025 | - | NZ_CP047897.1 | Nibribacter ruber |
| 79 | 9281757 | 9282056 | - | NZ_CP063373.1 | Streptomyces ferrugineus |
| 80 | 1056699 | 1056947 | + | NC_013959.1 | Sideroxydans lithotrophicus ES-1 |
| 81 | 4546405 | 4546695 | + | NZ_CP024957.1 | Streptomyces cavourensis |
| 82 | 117163 | 117465 | + | NZ_CP015136.1 | Luteitalea pratensis |
| 83 | 1461606 | 1461857 | - | NZ_CP030126.1 | Indioceanicola profundi |
| 84 | 3772311 | 3772574 | - | NZ_CP029480.1 | Arcticibacterium luteifluviistationis |
| 85 | 4750514 | 4750813 | + | NZ_CP070242.1 | Streptomyces californicus |
| 86 | 4796782 | 4797081 | + | NZ_CP020570.1 | Streptomyces violaceoruber |
| 87 | 4767082 | 4767381 | + | NZ_CP020700.1 | Streptomyces tsukubensis |
| 88 | 4644451 | 4644750 | + | NZ_CP042266.1 | Streptomyces qinzhouensis |
| 89 | 4733955 | 4734254 | + | NZ_CP013738.1 | Streptomyces globisporus C-1027 |
| 90 | 4856915 | 4857214 | + | NZ_CP020563.1 | Kitasatospora albolonga |
| 91 | 3941792 | 3942055 | + | NZ_CP029188.1 | Streptomyces tirandamycinicus |
| 92 | 3474773 | 3475072 | - | NC_010572.1 | Streptomyces griseus subsp. griseus NBRC 13350 |
| 93 | 66779 | 67108 | + | NZ_CP010777.1 | Rufibacter radiotolerans |
| 94 | 4275868 | 4276167 | - | NC_013929.1 | Streptomyces scabiei 87.22 |
| 95 | 4203102 | 4203365 | + | NZ_CP029254.1 | Streptomyces spongiicola |
| 96 | 1093175 | 1093477 | + | NZ_CP009530.1 | Methanosarcina barkeri 227 |
| 97 | 1924382 | 1924684 | + | NZ_CP009520.1 | Methanosarcina vacuolata Z-761 |
| 98 | 218936 | 219229 | + | NC_015672.1 | Flexistipes sinusarabici DSM 4947 |
| 99 | 1948920 | 1949228 | + | NZ_CP009506.1 | Methanosarcina siciliae T4/M |
| 100 | 3674668 | 3674931 | - | NZ_CP026652.1 | Streptomyces dengpaensis |
| 101 | 546509 | 546811 | + | NC_011979.1 | Geobacter daltonii FRC-32 |
| 102 | 5509804 | 5510067 | + | NZ_CP022685.1 | Streptomyces formicae |
| 103 | 4897174 | 4897476 | - | NC_009483.1 | Geobacter uraniireducens Rf4 |
| 104 | 1929767 | 1930072 | - | NC_008789.1 | Halorhodospira halophila SL1 |
| 105 | 969978 | 970247 | + | NC_019974.1 | Natronococcus occultus SP4 |
| 106 | 4587414 | 4587677 | + | NZ_CP023695.1 | Streptomyces alboniger |
| 107 | 3984537 | 3984827 | + | NZ_CP041091.1 | Nocardioides sambongensis |
| 108 | 1778791 | 1779057 | + | NZ_CP030356.1 | Salinibacter ruber |
| 109 | 3359771 | 3360073 | - | NZ_CP009788.1 | Geobacter pickeringii |
| 110 | 5189940 | 5190227 | - | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 111 | 3762699 | 3763001 | - | NC_007517.1 | Geobacter metallireducens GS-15 |
| 112 | 2739088 | 2739351 | - | NZ_AP023172.1 | Rhodococcus qingshengii |
| 113 | 4323555 | 4323857 | - | NZ_AP023213.1 | Citrifermentans bremense |
| 114 | 4455026 | 4455328 | - | NC_011146.1 | Citrifermentans bemidjiense Bem |
| 115 | 458962 | 459228 | + | NC_021880.1 | Anaplasma phagocytophilum str. JM |
| 116 | 284640 | 284942 | + | NZ_CP010802.1 | Desulfuromonas soudanensis |
| 117 | 179861 | 180133 | - | NC_005042.1 | Prochlorococcus marinus subsp. marinus str. CCMP1375 |
| 118 | 572335 | 572586 | - | NZ_AP018795.1 | Acidithiobacillus ferridurans |
| 119 | 2531331 | 2531582 | - | NC_015942.1 | Acidithiobacillus ferrivorans SS3 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_017094.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00361.22 | 0.98 | 117 | 1985 | same-strand | Proton-conducting membrane transporter |
| 2 | PF00662.22 | 0.97 | 116 | 14.0 | same-strand | NADH-Ubiquinone oxidoreductase (complex I), chain 5 N-terminus |
| 3 | PF00499.22 | 0.79 | 94 | 21.0 | same-strand | NADH-ubiquinone/plastoquinone oxidoreductase chain 6 |
| 4 | PF12838.9 | 0.88 | 105 | 836 | same-strand | 4Fe-4S dicluster domain |
| 5 | PF00037.29 | 0.88 | 105 | 818 | same-strand | 4Fe-4S binding domain |
| 6 | PF13187.8 | 0.88 | 105 | 823.0 | same-strand | 4Fe-4S dicluster domain |
| 7 | PF13237.8 | 0.88 | 105 | 834.5 | same-strand | 4Fe-4S dicluster domain |
| 8 | PF00146.23 | 0.87 | 104 | 1344.5 | same-strand | NADH dehydrogenase |
| 9 | PF13510.8 | 0.67 | 80 | 2629.5 | same-strand | 2Fe-2S iron-sulfur cluster binding domain |
| 10 | PF10588.11 | 0.67 | 80 | 2629.5 | same-strand | NADH-ubiquinone oxidoreductase-G iron-sulfur binding region |
| 11 | PF01512.19 | 0.66 | 78 | 5027.0 | same-strand | Respiratory-chain NADH dehydrogenase 51 Kd subunit |
| 12 | PF10589.11 | 0.66 | 78 | 5027.0 | same-strand | NADH-ubiquinone oxidoreductase-F iron-sulfur binding region |
| 13 | PF00111.29 | 0.66 | 78 | 2667.0 | same-strand | 2Fe-2S iron-sulfur cluster binding domain |
| 14 | PF13183.8 | 0.61 | 73 | 851 | same-strand | 4Fe-4S dicluster domain |
++ More..