Protein Information |
Information Type | Description |
---|---|
Protein name | EXP02632 |
NCBI Accession ID | |
Organism | Lachnospira |
Left | |
Right | |
Strand | |
Nucleotide Sequence | ATGAGCCTTGAGCAATACGATCAGATTATGAAGGCGGCGCATAATGCGGAATATCTTGCTATGATCGACAGGTCTATGGATCAGCTTTCAAGCGGAAACGGCAAGCAGCACGATCTTATCGAGGTAGACGATGACTAA |
Sequence | MSLEQYDQIMKAAHNAEYLAMIDRSMDQLSSGNGKQHDLIEVDDD |
Source of smORF | Metagenomic Ribo-seq |
Function | |
Pubmed ID | 32601270 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 45 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 4468951 | 4469061 | - | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
2 | 806402 | 806515 | + | NZ_LT906446.1 | Megamonas hypermegale |
3 | 1094757 | 1094867 | - | NZ_AP019829.2 | Leptotrichia wadei |
4 | 1080941 | 1081051 | + | NZ_AP019827.1 | Leptotrichia shahii |
5 | 1816641 | 1816754 | - | NZ_AP019822.1 | Pseudoleptotrichia goodfellowii |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF06769.16 | 0.6 | 3 | -7 | same-strand | YoeB-like toxin of bacterial type II toxin-antitoxin system |