Result : EXP02625
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02625 |
| NCBI Accession ID | |
| Organism | |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGACACTGTTTGGCACAGTGGATTTGTTGGGACTCAACGAGGGCTTTTGGGTGTCCATGGCGGTGGTCGCGCTGATCGTGGTCGTGATGAATGCCGTTTTTGGGGGTATGAAGCCCCGGAAGAAAGCGACCAGCGAAGTCAAGCGCACCTGA |
| Sequence | MTLFGTVDLLGLNEGFWVSMAVVALIVVVMNAVFGGMKPRKKATSEVKRT |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 50 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1615959 | 1616105 | + | NZ_CP036345.1 | Anaerostipes caccae L1-92 |
| 2 | 1723490 | 1723642 | - | NZ_CP036170.1 | [Clostridium] scindens ATCC 35704 |
| 3 | 4688005 | 4688163 | - | NZ_CP039126.1 | Blautia producta |
| 4 | 2008576 | 2008722 | + | NZ_CP022464.2 | Enterocloster bolteae |
| 5 | 1384995 | 1385177 | - | NC_014624.2 | Eubacterium callanderi |
| 6 | 112360 | 112542 | - | NZ_CP029487.1 | Eubacterium maltosivorans |
| 7 | 2363172 | 2363354 | - | NZ_CP019962.1 | Eubacterium limosum |
| 8 | 4292880 | 4293014 | - | NZ_CP034346.1 | Paenibacillus lutimineralis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP036170.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00486.30 | 0.75 | 6 | 3537 | same-strand | Transcriptional regulatory protein, C terminal |
| 2 | PF02308.18 | 0.88 | 7 | 3440 | same-strand | MgtC family |
| 3 | PF12650.9 | 1.0 | 8 | 2964.0 | same-strand | Domain of unknown function (DUF3784) |
| 4 | PF00122.22 | 1.0 | 8 | 34 | same-strand | E1-E2 ATPase |
| 5 | PF00702.28 | 1.0 | 8 | 34 | same-strand | haloacid dehalogenase-like hydrolase |
| 6 | PF00690.28 | 1.0 | 8 | 34 | same-strand | Cation transporter/ATPase, N-terminus |
| 7 | PF00689.23 | 0.62 | 5 | 837.0 | same-strand | Cation transporting ATPase, C-terminus |
++ More..