Result : EXP02624
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02624 |
| NCBI Accession ID | |
| Organism | Holdemania |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGACATTAGGAGAAAAGCTGCAGACGCTACGCCGCTCCCGCGGCCTGTCGCAGGAGCAGCTGGCCGAAATACTTGAGGTGTCGCGCCAGGCGGTCAGCAAGTGGGAAAACGGCGACTCCGCGCCGGACCTCGACAGGCTCCGCGCGATCTGA |
| Sequence | MTLGEKLQTLRRSRGLSQEQLAEILEVSRQAVSKWENGDSAPDLDRLRAI |
| Source of smORF | Metagenomic Ribo-seq |
| Function | The ORF matches to the profile of cl22854. Profile Description: N/A. YdaS_antitoxin is a family of putative bacterial antitoxins, neutralising the toxin YdaT, family pfam06254. |
| Pubmed ID | 32601270 |
| Domain | CDD:419869 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 50 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1110936 | 1111073 | + | NZ_CP039126.1 | Blautia producta |
| 2 | 4249649 | 4249798 | + | NZ_CP029487.1 | Eubacterium maltosivorans |
| 3 | 1779330 | 1779497 | + | NZ_CP014163.1 | Aerococcus urinaehominis |
| 4 | 468054 | 468212 | + | NZ_LR590481.1 | Hathewaya histolytica |
| 5 | 144370 | 144507 | + | NZ_CP018062.1 | Enterococcus mundtii |
++ More..