Result : EXP02605
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02605 |
| NCBI Accession ID | |
| Organism | Prevotella,Porphyromonas,Bacteroides |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGGCAACAAAAATCAGATTGCAAAGACATGGACGTAAAAGCTACGCTTTCTACTCTATCGTTATTGCAGACGTAAGAGCACCACGTGATGGTAAATTTATTGAGAAGATTGGTACTTACAATCCTAACACCAATCCTGCCACAGTAGATTGA |
| Sequence | MATKIRLQRHGRKSYAFYSIVIADVRAPRDGKFIEKIGTYNPNTNPATVD |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 50 |
++ More..
| Conservation Analysis |
No. of Species: 35
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 422189 | 422356 | - | NZ_LR215037.1 | Mycoplasmopsis maculosa |
| 2 | 8748 | 8891 | - | NZ_CP041664.1 | Mycoplasma anserisalpingitidis |
| 3 | 8040 | 8183 | - | NZ_CP030141.1 | Mycoplasmopsis anatis |
| 4 | 361074 | 361217 | - | NC_021283.1 | Mycoplasma hyopneumoniae 168-L |
| 5 | 3069 | 3212 | + | NZ_LR214986.1 | Mycoplasmopsis cynos |
| 6 | 69514 | 69681 | + | NZ_LR215042.1 | Mycoplasmopsis meleagridis |
| 7 | 333585 | 333728 | + | NZ_CP024161.1 | Mycoplasma dispar |
| 8 | 742628 | 742795 | + | NC_009497.1 | Mycoplasmopsis agalactiae PG2 |
| 9 | 807310 | 807477 | + | NZ_CP005933.1 | Mycoplasmopsis bovis CQ-W70 |
| 10 | 318927 | 319094 | - | NZ_LR214951.1 | Mycoplasma neurolyticum |
| 11 | 537318 | 537461 | - | NC_006908.1 | Mycoplasma mobile 163K |
| 12 | 13525 | 13668 | + | NZ_CP029258.1 | Mycoplasmopsis synoviae |
| 13 | 798032 | 798175 | + | NZ_LS991951.1 | Mycoplasmopsis edwardii |
| 14 | 3237 | 3380 | + | NZ_CP011368.1 | Mycoplasmopsis canis |
| 15 | 933810 | 933977 | - | NZ_CP002082.1 | Spiroplasma mirum ATCC 29335 |
| 16 | 961701 | 961868 | - | NZ_CP011855.1 | Spiroplasma atrichopogonis |
| 17 | 1139988 | 1140155 | - | NZ_CP011856.1 | Spiroplasma eriocheiris |
| 18 | 109226 | 109369 | + | NZ_LR215024.1 | Mycoplasmopsis glycophila |
| 19 | 519939 | 520082 | - | NZ_LR215031.1 | Mycoplasmopsis gallopavonis |
| 20 | 463489 | 463632 | - | NZ_LR215043.1 | Mycoplasmopsis columbinasalis |
| 21 | 398915 | 399058 | - | NZ_LR214950.1 | Mycoplasmopsis gallinacea |
| 22 | 638687 | 638830 | + | NC_014014.1 | Mycoplasma crocodyli MP145 |
| 23 | 437149 | 437316 | + | NZ_CP031376.1 | Spiroplasma alleghenense |
| 24 | 724116 | 724259 | + | NZ_LR215039.1 | Mycoplasmopsis columboralis |
| 25 | 171250 | 171393 | + | NZ_CP007154.1 | Mycoplasma bovoculi M165/69 |
| 26 | 269420 | 269587 | + | NC_021284.1 | Spiroplasma syrphidicola EA-1 |
| 27 | 246537 | 246704 | + | NC_021280.1 | Spiroplasma chrysopicola DF-1 |
| 28 | 659701 | 659844 | + | NZ_LR215036.1 | Mycoplasmopsis citelli |
| 29 | 389847 | 390014 | + | NZ_CP025057.1 | Spiroplasma floricola 23-6 |
| 30 | 297677 | 297844 | + | NZ_CP025543.1 | Spiroplasma monobiae MQ-1 |
| 31 | 564926 | 565069 | - | NZ_LR214972.1 | Mycoplasmopsis bovirhinis |
| 32 | 317072 | 317239 | + | NC_021846.1 | Spiroplasma taiwanense CT-1 |
| 33 | 309366 | 309533 | + | NC_021833.1 | Spiroplasma diminutum CUAS-1 |
| 34 | 473593 | 473760 | - | NZ_LS991954.1 | Mycoplasma putrefaciens |
| 35 | 436074 | 436241 | + | NZ_CP007520.1 | Mycoplasma yeatsii GM274B |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR215037.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01245.22 | 0.89 | 31 | 772 | same-strand | Ribosomal protein L19 |
| 2 | PF01746.23 | 0.8 | 28 | 104.5 | same-strand | tRNA (Guanine-1)-methyltransferase |
++ More..