Result : B5YIU7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | CRISPR-associated endoribonuclease Cas2 3 (EC 3.1.-.-) |
| NCBI Accession ID | CP001147.1 |
| Organism | Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) |
| Left | 1937715 |
| Right | 1937981 |
| Strand | - |
| Nucleotide Sequence | ATGCCTTATTTAATCGTCACATATGACATTGCTGAAGAGAGAGTAAACAAGGTTCGCAAAATACTTAAGAAGTATTTCATGTGGGTGCAGAACTCTGTATTTGAGGGAGAGATAACAGAGGGAAAGCTTTTAAAATGTAAGCTTGAACTGGAAAAGGTCATAGACAAAGAAGTAGATTCAGTATACTTCTACAGCCTTGAAAACAGGCTAAATTACAGAAAAACCGTATTAGGCATCGAAAAAGAAATAACGGGTAATATTTTATAG |
| Sequence | MPYLIVTYDIAEERVNKVRKILKKYFMWVQNSVFEGEITEGKLLKCKLELEKVIDKEVDSVYFYSLENRLNYRKTVLGIEKEITGNIL |
| Source of smORF | Swiss-Prot |
| Function | CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Functions as a ssRNA-specific endoribonuclease. Involved in the integration of spacer DNA into the CRISPR cassette. {ECO:0000255|HAMAP-Rule:MF_01471}. |
| Pubmed ID | |
| Domain | CDD:416272 |
| Functional Category | Metal-binding |
| Uniprot ID | B5YIU7 |
| ORF Length (Amino Acid) | 88 |
++ More..
| Conservation Analysis |
No. of Species: 46
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1721988 | 1722254 | - | NZ_AP022873.1 | Dissulfurispira thermophila |
| 2 | 1989925 | 1990188 | + | NC_014758.1 | Calditerrivibrio nitroreducens DSM 19672 |
| 3 | 269123 | 269389 | + | NC_017096.1 | Caldisericum exile AZM16c01 |
| 4 | 438884 | 439150 | + | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
| 5 | 351830 | 352087 | - | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
| 6 | 73360 | 73623 | - | NC_011297.1 | Dictyoglomus thermophilum H-6-12 |
| 7 | 144890 | 145105 | + | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
| 8 | 2468588 | 2468836 | + | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
| 9 | 25833 | 26102 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 10 | 2207069 | 2207308 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 11 | 343642 | 343866 | + | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 12 | 2524810 | 2525034 | - | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 13 | 915736 | 915975 | + | NZ_LT906477.1 | Clostridium cochlearium |
| 14 | 2130510 | 2130773 | + | NZ_CP014176.1 | Clostridium argentinense |
| 15 | 100890 | 101138 | - | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
| 16 | 1825209 | 1825472 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 17 | 3341571 | 3341822 | + | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 18 | 1268477 | 1268731 | + | NC_012440.1 | Persephonella marina EX-H1 |
| 19 | 5281037 | 5281252 | - | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 20 | 1609683 | 1609946 | - | NZ_CP014334.1 | Fervidobacterium islandicum |
| 21 | 755265 | 755531 | + | NC_012438.1 | Sulfurihydrogenibium azorense Az-Fu1 |
| 22 | 217394 | 217657 | + | NZ_HG917868.1 | Clostridium bornimense |
| 23 | 1360561 | 1360824 | + | NZ_CP032416.1 | Clostridium fermenticellae |
| 24 | 368471 | 368686 | - | NZ_CP023671.1 | Clostridium septicum |
| 25 | 3020390 | 3020641 | - | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 26 | 751648 | 751914 | + | NZ_CP019870.1 | Clostridioides difficile |
| 27 | 2405690 | 2405914 | - | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 28 | 1995260 | 1995475 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 29 | 1276963 | 1277214 | - | NC_011295.1 | Coprothermobacter proteolyticus DSM 5265 |
| 30 | 1033025 | 1033240 | + | NC_009718.1 | Fervidobacterium nodosum Rt17-B1 |
| 31 | 2119729 | 2119992 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 32 | 250090 | 250353 | - | NZ_AP014510.1 | Thermotoga profunda AZM34c06 |
| 33 | 2174590 | 2174823 | + | NZ_CP007536.1 | Nitrososphaera viennensis EN76 |
| 34 | 2798620 | 2798835 | - | NZ_CP012024.1 | Bacillus smithii |
| 35 | 1258720 | 1258935 | - | NC_011653.1 | Thermosipho africanus TCF52B |
| 36 | 1461412 | 1461627 | + | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
| 37 | 1535578 | 1535829 | - | NZ_LT719092.1 | Cuniculiplasma divulgatum |
| 38 | 2814267 | 2814530 | - | NZ_CP061336.1 | Ruminiclostridium herbifermentans |
| 39 | 214358 | 214582 | - | NC_009828.1 | Pseudothermotoga lettingae TMO |
| 40 | 208752 | 208976 | - | NC_022792.1 | Pseudothermotoga elfii DSM 9442 = NBRC 107921 |
| 41 | 140911 | 141150 | + | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 42 | 2668934 | 2669173 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 43 | 2326516 | 2326755 | - | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 44 | 1124939 | 1125166 | - | NC_017161.1 | Hydrogenobacter thermophilus TK-6 |
| 45 | 286503 | 286766 | + | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 46 | 694102 | 694326 | + | NC_013385.1 | Ammonifex degensii KC4 |
| 47 | 1119463 | 1119711 | + | NC_000961.1 | Pyrococcus horikoshii OT3 |
| 48 | 1049379 | 1049612 | + | NZ_CP023154.1 | Pyrococcus furiosus DSM 3638 |
| 49 | 1312095 | 1312358 | - | NZ_CP040463.1 | Caminibacter mediatlanticus TB-2 |
| 50 | 819876 | 820157 | + | NZ_CP025197.1 | Acetivibrio saccincola |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP022873.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01867.18 | 0.93 | 43 | 40 | same-strand | CRISPR associated protein Cas1 |
| 2 | PF01930.19 | 0.89 | 41 | 1030 | same-strand | Domain of unknown function DUF83 |
| 3 | PF00270.31 | 0.8 | 37 | 1568 | same-strand | DEAD/DEAH box helicase |
| 4 | PF00271.33 | 0.76 | 35 | 1596.0 | same-strand | Helicase conserved C-terminal domain |
++ More..