Result : EXP02593
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02593 |
| NCBI Accession ID | |
| Organism | Oribacterium,Leptotrichia |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGATGAGTGATTTAAAAAATAAAAAAATAATCATTATCGGAGATAGAGACGGTATACCTGGTCAAGCTATCGAAGAATGTGTAAAAACTATTGAAGGAACAGAGATCGTATTTGCATCTACTGAATGCTTTGGCTGA |
| Sequence | MMSDLKNKKIIIIGDRDGIPGQAIEECVKTIEGTEIVFASTECFG |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 45 |
++ More..
| Conservation Analysis |
No. of Species: 61
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 800983 | 801117 | + | NZ_AP019822.1 | Pseudoleptotrichia goodfellowii |
| 2 | 1442660 | 1442794 | + | NZ_CP019870.1 | Clostridioides difficile |
| 3 | 179277 | 179411 | + | NZ_LR134484.1 | Gemella haemolysans |
| 4 | 1853568 | 1853702 | - | NZ_CP036523.1 | Peptacetobacter hiranonis |
| 5 | 40652 | 40783 | + | NZ_CP022464.2 | Enterocloster bolteae |
| 6 | 4496072 | 4496203 | - | NZ_CP022464.2 | Enterocloster bolteae |
| 7 | 861024 | 861146 | + | NZ_LT635479.1 | Lachnoclostridium phocaeense |
| 8 | 3019067 | 3019198 | - | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 9 | 3073570 | 3073701 | - | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 10 | 3093590 | 3093724 | + | NC_014150.1 | Brachyspira murdochii DSM 12563 |
| 11 | 2034529 | 2034663 | + | NC_014330.1 | Brachyspira pilosicoli 95/1000 |
| 12 | 3092872 | 3093000 | - | NC_006177.1 | Symbiobacterium thermophilum IAM 14863 |
| 13 | 439130 | 439255 | - | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 14 | 927332 | 927457 | - | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 15 | 535928 | 536059 | - | NZ_CP070062.1 | Coprococcus comes |
| 16 | 2728485 | 2728616 | + | NZ_CP036170.1 | [Clostridium] scindens ATCC 35704 |
| 17 | 580628 | 580762 | + | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 18 | 452964 | 453086 | - | NZ_LT990039.1 | Massilistercora timonensis |
| 19 | 2196244 | 2196375 | - | NZ_CP009933.1 | Clostridium scatologenes |
| 20 | 2180617 | 2180748 | - | NZ_CP009933.1 | Clostridium scatologenes |
| 21 | 4148579 | 4148704 | - | NZ_CP009933.1 | Clostridium scatologenes |
| 22 | 1045704 | 1045835 | + | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 23 | 1060281 | 1060412 | + | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 24 | 4904075 | 4904200 | + | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 25 | 2097679 | 2097810 | + | NZ_CP020953.1 | Clostridium drakei |
| 26 | 2114536 | 2114667 | + | NZ_CP020953.1 | Clostridium drakei |
| 27 | 72078 | 72203 | + | NZ_CP020953.1 | Clostridium drakei |
| 28 | 2639414 | 2639548 | - | NZ_CP032416.1 | Clostridium fermenticellae |
| 29 | 2115094 | 2115222 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 30 | 709241 | 709366 | + | NZ_LR590481.1 | Hathewaya histolytica |
| 31 | 1385717 | 1385848 | + | NZ_CP011663.1 | Clostridium sporogenes |
| 32 | 780427 | 780558 | + | NC_002967.9 | Treponema denticola ATCC 35405 |
| 33 | 1391677 | 1391808 | + | NZ_CP009228.1 | Treponema putidum |
| 34 | 1306791 | 1306922 | + | NZ_CP009687.1 | Clostridium aceticum |
| 35 | 799609 | 799740 | + | NZ_CP009687.1 | Clostridium aceticum |
| 36 | 2202548 | 2202673 | - | NC_019978.1 | Halobacteroides halobius DSM 5150 |
| 37 | 3047748 | 3047879 | - | NZ_CP020559.1 | Clostridium formicaceticum |
| 38 | 976093 | 976224 | + | NZ_CP020559.1 | Clostridium formicaceticum |
| 39 | 1264997 | 1265128 | + | NC_014614.1 | Acetoanaerobium sticklandii |
| 40 | 1834754 | 1834885 | + | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 41 | 1290180 | 1290305 | + | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 42 | 2444271 | 2444396 | + | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 43 | 93389 | 93514 | + | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 44 | 1823093 | 1823218 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 45 | 1452155 | 1452280 | - | NZ_CP005973.1 | Photobacterium gaetbulicola Gung47 |
| 46 | 1451673 | 1451798 | - | NZ_CP005973.1 | Photobacterium gaetbulicola Gung47 |
| 47 | 400840 | 400974 | + | NZ_LT821227.1 | Phoenicibacter congonensis |
| 48 | 2676249 | 2676380 | - | NZ_LR134379.1 | Slackia heliotrinireducens |
| 49 | 3687933 | 3688064 | - | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 50 | 2845030 | 2845152 | + | NC_016584.1 | Desulfosporosinus orientis DSM 765 |
| 51 | 2252373 | 2252498 | + | NC_016584.1 | Desulfosporosinus orientis DSM 765 |
| 52 | 1381562 | 1381693 | + | NZ_CP028842.1 | Clostridium botulinum |
| 53 | 5198855 | 5198986 | + | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 54 | 1215410 | 1215535 | - | NZ_CP016379.1 | Anoxybacter fermentans |
| 55 | 2141338 | 2141469 | + | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 56 | 512352 | 512477 | + | NC_017455.1 | Halanaerobium praevalens DSM 2228 |
| 57 | 160949 | 161077 | + | NC_017455.1 | Halanaerobium praevalens DSM 2228 |
| 58 | 501696 | 501821 | + | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 59 | 1242510 | 1242638 | - | NZ_CP049886.1 | Vagococcus coleopterorum |
| 60 | 1239313 | 1239441 | - | NZ_CP049886.1 | Vagococcus coleopterorum |
| 61 | 3188039 | 3188164 | - | NZ_CP014176.1 | Clostridium argentinense |
| 62 | 1726112 | 1726246 | - | NZ_CP035130.1 | Gudongella oleilytica |
| 63 | 2428383 | 2428514 | - | NZ_CP060720.1 | Vagococcus carniphilus |
| 64 | 2425212 | 2425343 | - | NZ_CP060720.1 | Vagococcus carniphilus |
| 65 | 752479 | 752613 | + | NZ_CP009761.1 | Parvimonas micra |
| 66 | 493959 | 494090 | - | NZ_LT635475.1 | Ezakiella massiliensis |
| 67 | 1329945 | 1330073 | + | NC_022097.1 | Treponema pedis str. T A4 |
| 68 | 1766379 | 1766507 | + | NZ_CP049887.1 | Vagococcus hydrophili |
| 69 | 1769701 | 1769829 | + | NZ_CP049887.1 | Vagococcus hydrophili |
| 70 | 1599247 | 1599372 | - | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 71 | 220749 | 220874 | + | NC_011295.1 | Coprothermobacter proteolyticus DSM 5265 |
| 72 | 762859 | 762990 | - | NZ_CP007453.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 73 | 1146553 | 1146678 | + | NC_014378.1 | Acetohalobium arabaticum DSM 5501 |
| 74 | 2396570 | 2396695 | - | NC_014378.1 | Acetohalobium arabaticum DSM 5501 |
| 75 | 2389739 | 2389864 | - | NC_014378.1 | Acetohalobium arabaticum DSM 5501 |
| 76 | 1703389 | 1703520 | - | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 77 | 879244 | 879375 | + | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 78 | 1699914 | 1700045 | - | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 79 | 2847953 | 2848087 | - | NZ_CP014150.1 | Paeniclostridium sordellii |
| 80 | 456359 | 456487 | + | NZ_CP028897.1 | Dongshaea marina |
| 81 | 1196452 | 1196583 | - | NC_013522.1 | Thermanaerovibrio acidaminovorans DSM 6589 |
| 82 | 5085341 | 5085472 | - | NC_018025.1 | Desulfomonile tiedjei DSM 6799 |
| 83 | 2339431 | 2339556 | - | NC_007759.1 | Syntrophus aciditrophicus SB |
| 84 | 382512 | 382649 | + | NC_018024.1 | Acetomicrobium mobile DSM 13181 |
| 85 | 1015471 | 1015599 | - | NC_018024.1 | Acetomicrobium mobile DSM 13181 |
| 86 | 1359012 | 1359143 | - | NC_016148.1 | Thermovirga lienii DSM 17291 |
| 87 | 1046301 | 1046432 | + | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP019822.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07992.16 | 0.9 | 55 | 1413 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
| 2 | PF00070.29 | 0.9 | 55 | 1413 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
| 3 | PF00085.22 | 0.92 | 56 | 1316 | same-strand | Thioredoxin |
| 4 | PF09338.13 | 0.92 | 56 | 84 | same-strand | Glycine/sarcosine/betaine reductase component B subunits |
| 5 | PF07355.14 | 0.9 | 55 | 471.5 | same-strand | Glycine/sarcosine/betaine reductase selenoprotein B (GRDB) |
| 6 | PF19364.1 | 0.93 | 57 | 1705 | same-strand | Family of unknown function (DUF5940) |
| 7 | PF08545.12 | 0.92 | 56 | 1303.5 | same-strand | 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III |
| 8 | PF02504.17 | 0.9 | 55 | 2852.0 | same-strand | Fatty acid synthesis protein |
++ More..