Result : B5YG45
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L23 |
| NCBI Accession ID | CP001147.1 |
| Organism | Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) |
| Left | 1381801 |
| Right | 1382088 |
| Strand | - |
| Nucleotide Sequence | ATGGATATTTACAGCATAATAAAAAAACCTGTTTTTACAGAAAAAGCTTTGAATCTCAAAGAAAGTCAAAATAAGGTTGTTATAGAGGTTCATCCTGATGTAAACAAGGTTCAGGTTAAGAAAGCTTTTGAGGAGATATTTAAAGTTAAGGTTGACAGTGTGAGCATTATTAATGTGAAGCCGAAAATAAAAAGAGTTGGACTTCATTTCACGAAGACAAAAAAAACAAAAAAAGCAATAGTTACCCTGAAAGCAGGGGAGAAATTAGATTTGATAGAGGGTGTATAA |
| Sequence | MDIYSIIKKPVFTEKALNLKESQNKVVIEVHPDVNKVQVKKAFEEIFKVKVDSVSIINVKPKIKRVGLHFTKTKKTKKAIVTLKAGEKLDLIEGV |
| Source of smORF | Swiss-Prot |
| Function | One of the early assembly proteins it binds 23S rRNA. One of the proteins that surrounds the polypeptide exit tunnel on the outside of the ribosome. Forms the main docking site for trigger factor binding to the ribosome. {ECO:0000255|HAMAP-Rule:MF_01369}. |
| Pubmed ID | |
| Domain | CDD:412311 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | B5YG45 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 80
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 441833 | 442069 | + | NZ_AP022873.1 | Dissulfurispira thermophila |
| 2 | 471303 | 471536 | + | NC_018024.1 | Acetomicrobium mobile DSM 13181 |
| 3 | 848556 | 848810 | + | NC_011297.1 | Dictyoglomus thermophilum H-6-12 |
| 4 | 1015906 | 1016193 | + | NC_011661.1 | Dictyoglomus turgidum DSM 6724 |
| 5 | 728698 | 728937 | - | NC_015707.1 | Pseudothermotoga thermarum DSM 5069 |
| 6 | 699074 | 699307 | + | NC_016148.1 | Thermovirga lienii DSM 17291 |
| 7 | 495641 | 495871 | + | NC_015672.1 | Flexistipes sinusarabici DSM 4947 |
| 8 | 723950 | 724234 | + | NC_008609.1 | Pelobacter propionicus DSM 2379 |
| 9 | 2597336 | 2597581 | - | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 10 | 1223454 | 1223687 | - | NC_013522.1 | Thermanaerovibrio acidaminovorans DSM 6589 |
| 11 | 1081887 | 1082165 | + | NZ_CP035108.1 | Geovibrio thiophilus |
| 12 | 108312 | 108587 | + | NZ_CP019573.1 | Abyssicoccus albus |
| 13 | 984171 | 984443 | + | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 14 | 263181 | 263468 | + | NZ_CP002082.1 | Spiroplasma mirum ATCC 29335 |
| 15 | 289535 | 289822 | + | NZ_CP011855.1 | Spiroplasma atrichopogonis |
| 16 | 306365 | 306652 | + | NZ_CP011856.1 | Spiroplasma eriocheiris |
| 17 | 514688 | 514975 | + | NZ_CP068114.1 | Fusobacterium canifelinum |
| 18 | 1674261 | 1674548 | + | NZ_CP024699.1 | Fusobacterium pseudoperiodonticum |
| 19 | 566320 | 566607 | + | NZ_CP013336.1 | Fusobacterium hwasookii ChDC F206 |
| 20 | 427007 | 427294 | + | NZ_LN831027.1 | Fusobacterium nucleatum subsp. polymorphum |
| 21 | 48694 | 48975 | + | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 22 | 1669466 | 1669744 | - | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 23 | 398883 | 399167 | + | NZ_CP031376.1 | Spiroplasma alleghenense |
| 24 | 428880 | 429164 | - | NZ_CP018888.1 | Amylolactobacillus amylophilus DSM 20533 = JCM 1125 |
| 25 | 345083 | 345313 | + | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 26 | 242879 | 243166 | + | NC_021284.1 | Spiroplasma syrphidicola EA-1 |
| 27 | 2840484 | 2840744 | - | NZ_AP022608.1 | Mycolicibacterium gadium |
| 28 | 220030 | 220317 | + | NC_021280.1 | Spiroplasma chrysopicola DF-1 |
| 29 | 475735 | 476013 | + | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 30 | 2259110 | 2259346 | - | NC_014220.1 | Syntrophothermus lipocalidus DSM 12680 |
| 31 | 558708 | 558986 | + | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 32 | 651627 | 651902 | - | NZ_CP020773.1 | Staphylococcus lutrae |
| 33 | 268037 | 268309 | + | NZ_CP011366.1 | Salinicoccus halodurans |
| 34 | 2478235 | 2478489 | - | NZ_CP033896.1 | Corynebacterium choanae |
| 35 | 1318110 | 1318412 | + | NC_023151.1 | Thermotoga maritima MSB8 |
| 36 | 159518 | 159808 | + | NZ_LS991954.1 | Mycoplasma putrefaciens |
| 37 | 5230821 | 5231090 | + | NZ_AP022620.1 | Mycolicibacterium anyangense |
| 38 | 787266 | 787541 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 39 | 1279694 | 1279969 | + | NZ_CP027770.1 | Staphylococcus felis |
| 40 | 1288093 | 1288377 | + | NZ_CP023643.1 | Brochothrix thermosphacta |
| 41 | 181189 | 181476 | + | NZ_CP034118.1 | Staphylospora marina |
| 42 | 3982398 | 3982691 | - | NZ_LR134355.1 | Mycolicibacterium chitae |
| 43 | 1728916 | 1729191 | - | NZ_LT906464.1 | Staphylococcus muscae |
| 44 | 5538772 | 5539032 | + | NZ_AP022601.1 | Mycobacterium gallinarum |
| 45 | 793718 | 794008 | - | NZ_CP007520.1 | Mycoplasma yeatsii GM274B |
| 46 | 1327527 | 1327829 | + | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 47 | 1303923 | 1304225 | + | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 48 | 610731 | 611006 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 49 | 5890559 | 5890852 | - | NZ_CP020809.1 | Mycobacterium dioxanotrophicus |
| 50 | 82593 | 82889 | + | NZ_CP031733.1 | Streptococcus chenjunshii |
| 51 | 2217556 | 2217816 | - | NZ_AP022603.1 | Mycolicibacterium fallax |
| 52 | 2316216 | 2316491 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 53 | 2167442 | 2167738 | + | NZ_CP014699.1 | Streptococcus pantholopis |
| 54 | 1628319 | 1628549 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 55 | 1127281 | 1127541 | + | NZ_LR134356.1 | Mycolicibacterium aurum |
| 56 | 1613813 | 1614115 | + | NZ_LN831039.1 | Mycolicibacterium smegmatis |
| 57 | 6774404 | 6774706 | - | NZ_CP012150.1 | Mycobacterium goodii |
| 58 | 2170601 | 2170876 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 59 | 5535098 | 5535358 | - | NZ_AP022574.1 | Mycolicibacterium psychrotolerans |
| 60 | 4401909 | 4402202 | + | NZ_AP022567.1 | Mycolicibacterium mageritense |
| 61 | 51070 | 51357 | - | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 62 | 633064 | 633357 | + | NZ_AP022605.1 | Mycobacterium doricum |
| 63 | 2524609 | 2524893 | - | NZ_AP019845.1 | Leptotrichia trevisanii |
| 64 | 2467389 | 2467682 | - | NZ_AP022565.1 | Mycolicibacterium alvei |
| 65 | 3750366 | 3750659 | - | NZ_AP022617.1 | Mycolicibacterium monacense |
| 66 | 1478630 | 1478923 | + | NZ_CP011269.1 | Mycolicibacterium fortuitum |
| 67 | 271361 | 271663 | + | NZ_CP031835.1 | Lactobacillus amylolyticus |
| 68 | 3277435 | 3277728 | - | NZ_AP022586.1 | Mycolicibacterium litorale |
| 69 | 233484 | 233738 | + | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 70 | 2133432 | 2133716 | - | NZ_AP019829.2 | Leptotrichia wadei |
| 71 | 1397711 | 1398004 | + | NZ_AP022618.1 | Mycolicibacterium insubricum |
| 72 | 1159634 | 1159894 | + | NZ_CP011491.1 | Mycolicibacterium vaccae 95051 |
| 73 | 4369137 | 4369367 | - | NZ_CP022657.1 | Tumebacillus algifaecis |
| 74 | 395219 | 395524 | + | NZ_CP059829.1 | Lactobacillus ultunensis |
| 75 | 92698 | 92994 | + | NZ_CP029491.1 | Streptococcus sobrinus |
| 76 | 275573 | 275833 | - | NZ_AP022598.1 | Mycolicibacterium parafortuitum |
| 77 | 2195072 | 2195362 | - | NZ_AP019822.1 | Pseudoleptotrichia goodfellowii |
| 78 | 3542366 | 3542626 | - | NZ_AP022563.1 | Mycolicibacterium duvalii |
| 79 | 6448119 | 6448412 | - | NZ_AP022579.1 | Mycolicibacterium boenickei |
| 80 | 1400927 | 1401187 | + | NC_008726.1 | Mycolicibacterium vanbaalenii PYR-1 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP022873.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00338.24 | 1.0 | 80 | 1351.0 | same-strand | Ribosomal protein S10p/S20e |
| 2 | PF00573.24 | 0.9 | 72 | 1.0 | same-strand | Ribosomal protein L4/L1 family |
| 3 | PF03947.20 | 0.89 | 71 | 31 | same-strand | Ribosomal Proteins L2, C-terminal domain |
| 4 | PF00181.25 | 0.99 | 79 | 33 | same-strand | Ribosomal Proteins L2, RNA binding domain |
| 5 | PF00203.23 | 0.9 | 72 | 891.0 | same-strand | Ribosomal protein S19 |
| 6 | PF00237.21 | 0.99 | 79 | 1192 | same-strand | Ribosomal protein L22p/L17e |
| 7 | PF00189.22 | 0.95 | 76 | 1621.0 | same-strand | Ribosomal protein S3, C-terminal domain |
| 8 | PF07650.19 | 0.96 | 77 | 1621 | same-strand | KH domain |
| 9 | PF00252.20 | 0.9 | 72 | 2276.5 | same-strand | Ribosomal protein L16p/L10e |
++ More..