Result : EXP02580

Protein Information

• Protein name: EXP02580
• Organism: Bacteroides,Parabacteroides,Prevotella,Odoribacter
• Nucleotide Sequence: ATGTACAAACATAAATTAAAAACAACGATTATATCCCATTTAAATTTTAATCAGCAAGAAATTTCAGTAAACTTGTTTGTGTTTCAGTATTTTGTTGTATCTTTGCGCCCGAAATTAGATAANCAATATAATGTCTAA
• Sequence: MYKHKLKTTIISHLNFNQQEISVNLFVFQYFVVSLRPKLDXQYNV
• Source of smORF: Metagenomic Ribo-seq
• Pubmed ID: 32601270
• Functional Category: Function not yet assigned
• ORF Length (Amino Acid): 45

Conservation Analysis

No. of Species: 2

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	3656431	3656568	-	NZ_LR699004.1	Phocaeicola dorei
2	3298367	3298504	-	NC_009614.1	Phocaeicola vulgatus ATCC 8482

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NZ_LR699004.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF04542.16	1.0	2	3559.5	same-strand	Sigma-70 region 2
2	PF08281.14	1.0	2	3559.5	same-strand	Sigma-70, region 4
3	PF04545.18	1.0	2	3559.5	same-strand	Sigma-70, region 4
4	PF00313.24	1.0	2	2079.5	same-strand	'Cold-shock' DNA-binding domain
5	PF00575.25	1.0	2	34.0	same-strand	S1 RNA binding domain
6	PF04402.16	1.0	2	351.0	same-strand	Protein of unknown function (DUF541)
7	PF13580.8	1.0	2	1056.0	same-strand	SIS domain
8	PF04397.17	1.0	2	4547.0	same-strand	LytTr DNA-binding domain
9	PF00072.26	1.0	2	4547.0	same-strand	Response regulator receiver domain