Result : EXP02577
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02577 |
| NCBI Accession ID | |
| Organism | Fusobacterium,Anaerotignum,Prevotella |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGCTCCCAAGTATGAAAAAAGAATGGGGATTAACAGAGCAACTAAAAATAGATGACCAAATGGAATGGGTAGGACTGATGAATAATTTGGAAGCAACTATTAAGGAAATAATTTTAAATGAATTAGTATATGTCTAA |
| Sequence | MLPSMKKEWGLTEQLKIDDQMEWVGLMNNLEATIKEIILNELVYV |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 45 |
++ More..
| Conservation Analysis |
No. of Species: 17
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1014104 | 1014247 | - | NZ_CP034413.2 | Dysosmobacter welbionis |
| 2 | 967409 | 967546 | - | NZ_CP034413.2 | Dysosmobacter welbionis |
| 3 | 2426219 | 2426356 | - | NZ_CP034413.2 | Dysosmobacter welbionis |
| 4 | 1048491 | 1048628 | - | NZ_CP034413.2 | Dysosmobacter welbionis |
| 5 | 2039686 | 2039823 | + | NZ_CP025286.1 | Ethanoligenens harbinense YUAN-3 |
| 6 | 639757 | 639879 | - | NZ_AP018940.1 | Mycoplasmopsis californica |
| 7 | 3378074 | 3378214 | + | NZ_LR130778.1 | Petrocella atlantisensis |
| 8 | 1052276 | 1052410 | + | NZ_AP019846.1 | Leptotrichia hongkongensis |
| 9 | 2874660 | 2874797 | + | NC_016048.1 | Oscillibacter valericigenes Sjm18-20 |
| 10 | 2408929 | 2409066 | - | NZ_LT635479.1 | Lachnoclostridium phocaeense |
| 11 | 549333 | 549458 | + | NZ_LT635479.1 | Lachnoclostridium phocaeense |
| 12 | 716641 | 716778 | - | NZ_LT990039.1 | Massilistercora timonensis |
| 13 | 3328429 | 3328566 | - | NZ_LR699011.1 | Roseburia hominis |
| 14 | 423560 | 423697 | + | NZ_LR699011.1 | Roseburia hominis |
| 15 | 2275682 | 2275819 | - | NZ_LR699011.1 | Roseburia hominis |
| 16 | 3291400 | 3291525 | - | NZ_LR699011.1 | Roseburia hominis |
| 17 | 338335 | 338457 | + | NZ_LR699011.1 | Roseburia hominis |
| 18 | 6426409 | 6426546 | - | NZ_CP022464.2 | Enterocloster bolteae |
| 19 | 6491015 | 6491152 | - | NZ_CP022464.2 | Enterocloster bolteae |
| 20 | 2786922 | 2787059 | + | NZ_CP027002.1 | [Ruminococcus] gnavus ATCC 29149 |
| 21 | 1286659 | 1286796 | + | NZ_CP030777.1 | Faecalibacterium prausnitzii |
| 22 | 447479 | 447625 | + | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 23 | 680340 | 680477 | + | NZ_CP039126.1 | Blautia producta |
| 24 | 1040208 | 1040321 | - | NC_013192.1 | Leptotrichia buccalis C-1013-b |
| 25 | 1432407 | 1432553 | + | NZ_HF545616.1 | Ruminococcus bicirculans |
| 26 | 238113 | 238247 | - | NZ_CP049740.1 | Jeotgalibaca arthritidis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP034413.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04851.17 | 0.76 | 13 | -137 | same-strand | Type III restriction enzyme, res subunit |
++ More..