Protein Information |
Information Type | Description |
---|---|
Protein name | 30S ribosomal protein S20 |
NCBI Accession ID | CP001146.1 |
Organism | Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) |
Left | 959355 |
Right | 959636 |
Strand | - |
Nucleotide Sequence | ATGGCAAATACAAAGTCAGCAATCAAAAGAATTAAAATTAGTGAAAGAAATAGAATCAGAAACAGAATCAGATTAGGTAAAATTAAATTTTACACTAAGCAATTTCTAAAATTATTAGAAGAGAATAAAATTGAAGAAGCAAAAAAAGTACTTCCTGAAGTAATAAGCGCCATTGACAAAGCAGCTCAAAAAGGCACCTTACACAAAAACACAGCAGCAAGAAAAAAGTCTAAACTTATGAGGCTTCTTAATCAAAAACTTTCAGCTAACCTTTCTTCCTAA |
Sequence | MANTKSAIKRIKISERNRIRNRIRLGKIKFYTKQFLKLLEENKIEEAKKVLPEVISAIDKAAQKGTLHKNTAARKKSKLMRLLNQKLSANLSS |
Source of smORF | Swiss-Prot |
Function | Binds directly to 16S ribosomal RNA. {ECO:0000255|HAMAP-Rule:MF_00500}. |
Pubmed ID | |
Domain | CDD:412349 |
Functional Category | Ribosomal_protein |
Uniprot ID | B5YE70 |
ORF Length (Amino Acid) | 93 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 959355 | 959636 | - | NC_011297.1 | Dictyoglomus thermophilum H-6-12 |
2 | 1126399 | 1126680 | - | NC_011661.1 | Dictyoglomus turgidum DSM 6724 |
3 | 598710 | 598982 | - | NZ_AP017470.1 | Thermotomaculum hydrothermale |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01551.24 | 0.67 | 2 | 4125.0 | opposite-strand | Peptidase family M23 |
2 | PF03572.20 | 0.67 | 2 | 2856.0 | opposite-strand | Peptidase family S41 |
3 | PF13180.8 | 0.67 | 2 | 2856.0 | opposite-strand | PDZ domain |
4 | PF17820.3 | 0.67 | 2 | 2856.0 | opposite-strand | PDZ domain |
5 | PF00595.26 | 0.67 | 2 | 2856.0 | opposite-strand | PDZ domain |
6 | PF12836.9 | 0.67 | 2 | 2295.0 | opposite-strand | Helix-hairpin-helix motif |
7 | PF10531.11 | 0.67 | 2 | 2295.0 | opposite-strand | SLBB domain |
8 | PF00633.25 | 0.67 | 2 | 2295.0 | opposite-strand | Helix-hairpin-helix motif |
9 | PF03772.18 | 0.67 | 2 | 947.0 | opposite-strand | Competence protein |
10 | PF06144.15 | 0.67 | 2 | -20.0 | opposite-strand | DNA polymerase III, delta subunit |
11 | PF00009.29 | 0.67 | 2 | 145.0 | opposite-strand | Elongation factor Tu GTP binding domain |
12 | PF06421.14 | 0.67 | 2 | 145.0 | opposite-strand | GTP-binding protein LepA C-terminus |
13 | PF00679.26 | 0.67 | 2 | 145.0 | opposite-strand | Elongation factor G C-terminus |
14 | PF03144.27 | 0.67 | 2 | 145.0 | opposite-strand | Elongation factor Tu domain 2 |
15 | PF14492.8 | 0.67 | 2 | 145.0 | opposite-strand | Elongation Factor G, domain III |
16 | PF01926.25 | 0.67 | 2 | 145.0 | opposite-strand | 50S ribosome-binding GTPase |
17 | PF01975.19 | 0.67 | 2 | 1951.5 | opposite-strand | Survival protein SurE |
18 | PF04055.23 | 0.67 | 2 | 2696.5 | opposite-strand | Radical SAM superfamily |
19 | PF06969.18 | 0.67 | 2 | 2696.5 | opposite-strand | HemN C-terminal domain |
20 | PF00072.26 | 0.67 | 2 | 3845.5 | opposite-strand | Response regulator receiver domain |
21 | PF03861.16 | 0.67 | 2 | 3845.5 | opposite-strand | ANTAR domain |
22 | PF00953.23 | 0.67 | 2 | 4438.5 | opposite-strand | Glycosyl transferase family 4 |