Result : B5YE70

Protein Information

• Protein name: 30S ribosomal protein S20
• NCBI Accession ID: CP001146.1
• Organism: Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
• Left: 959355
• Right: 959636
• Strand: -
• Nucleotide Sequence: ATGGCAAATACAAAGTCAGCAATCAAAAGAATTAAAATTAGTGAAAGAAATAGAATCAGAAACAGAATCAGATTAGGTAAAATTAAATTTTACACTAAGCAATTTCTAAAATTATTAGAAGAGAATAAAATTGAAGAAGCAAAAAAAGTACTTCCTGAAGTAATAAGCGCCATTGACAAAGCAGCTCAAAAAGGCACCTTACACAAAAACACAGCAGCAAGAAAAAAGTCTAAACTTATGAGGCTTCTTAATCAAAAACTTTCAGCTAACCTTTCTTCCTAA
• Sequence: MANTKSAIKRIKISERNRIRNRIRLGKIKFYTKQFLKLLEENKIEEAKKVLPEVISAIDKAAQKGTLHKNTAARKKSKLMRLLNQKLSANLSS
• Source of smORF: Swiss-Prot
• Function: Binds directly to 16S ribosomal RNA. {ECO:0000255|HAMAP-Rule:MF_00500}.
• Domain: CDD:412349
• Functional Category: Ribosomal_protein
• Uniprot ID: B5YE70
• ORF Length (Amino Acid): 93

Conservation Analysis

No. of Species: 3

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	959355	959636	-	NC_011297.1	Dictyoglomus thermophilum H-6-12
2	1126399	1126680	-	NC_011661.1	Dictyoglomus turgidum DSM 6724
3	598710	598982	-	NZ_AP017470.1	Thermotomaculum hydrothermale

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_011297.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF01551.24	0.67	2	4125.0	opposite-strand	Peptidase family M23
2	PF03572.20	0.67	2	2856.0	opposite-strand	Peptidase family S41
3	PF13180.8	0.67	2	2856.0	opposite-strand	PDZ domain
4	PF17820.3	0.67	2	2856.0	opposite-strand	PDZ domain
5	PF00595.26	0.67	2	2856.0	opposite-strand	PDZ domain
6	PF12836.9	0.67	2	2295.0	opposite-strand	Helix-hairpin-helix motif
7	PF10531.11	0.67	2	2295.0	opposite-strand	SLBB domain
8	PF00633.25	0.67	2	2295.0	opposite-strand	Helix-hairpin-helix motif
9	PF03772.18	0.67	2	947.0	opposite-strand	Competence protein
10	PF06144.15	0.67	2	-20.0	opposite-strand	DNA polymerase III, delta subunit
11	PF00009.29	0.67	2	145.0	opposite-strand	Elongation factor Tu GTP binding domain
12	PF06421.14	0.67	2	145.0	opposite-strand	GTP-binding protein LepA C-terminus
13	PF00679.26	0.67	2	145.0	opposite-strand	Elongation factor G C-terminus
14	PF03144.27	0.67	2	145.0	opposite-strand	Elongation factor Tu domain 2
15	PF14492.8	0.67	2	145.0	opposite-strand	Elongation Factor G, domain III
16	PF01926.25	0.67	2	145.0	opposite-strand	50S ribosome-binding GTPase
17	PF01975.19	0.67	2	1951.5	opposite-strand	Survival protein SurE
18	PF04055.23	0.67	2	2696.5	opposite-strand	Radical SAM superfamily
19	PF06969.18	0.67	2	2696.5	opposite-strand	HemN C-terminal domain
20	PF00072.26	0.67	2	3845.5	opposite-strand	Response regulator receiver domain
21	PF03861.16	0.67	2	3845.5	opposite-strand	ANTAR domain
22	PF00953.23	0.67	2	4438.5	opposite-strand	Glycosyl transferase family 4