| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02569 |
| NCBI Accession ID | |
| Organism | Treponema,Anaerotruncus |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGAAAAAGAAAATAGCGGCAATACTTGTTATTATTTTAGCATTAAGCTTTACCCTTATAGGAATATACCGCGGTGAAGTTGCTGTAGTCCTCAAAAAGGCTGTAAATATATGTATGGAGTGTATAGGAATNGGCTAA |
| Sequence | MKKKIAAILVIILALSFTLIGIYRGEVAVVLKKAVNICMECIGXG |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 45 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2403530 | 2403667 | + | NC_002967.9 | Treponema denticola ATCC 35405 |
| 2 | 2463999 | 2464136 | + | NC_022097.1 | Treponema pedis str. T A4 |
| 3 | 1430003 | 1430113 | + | NZ_LT821227.1 | Phoenicibacter congonensis |
| 4 | 2108168 | 2108278 | - | NC_018664.1 | Gottschalkia acidurici 9a |
| 5 | 26269 | 26385 | + | NC_013895.2 | Mageeibacillus indolicus UPII9-5 |
| 6 | 20726 | 20878 | - | NZ_CP031518.1 | Treponema ruminis |
| 7 | 782234 | 782344 | - | NZ_CP007453.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 8 | 1150157 | 1150276 | + | NC_016048.1 | Oscillibacter valericigenes Sjm18-20 |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00578.23 | 1.0 | 8 | 317 | same-strand | AhpC/TSA family |
| 2 | PF08534.12 | 0.88 | 7 | 414.5 | same-strand | Redoxin |
| 3 | PF13905.8 | 1.0 | 8 | 223.0 | same-strand | Thioredoxin-like |
| 4 | PF12801.9 | 0.88 | 7 | 0 | same-strand | 4Fe-4S binding domain |