Result : B5Y980
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L29 |
| NCBI Accession ID | CP001145.1 |
| Organism | Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / OCM 4 / BT) |
| Left | 887891 |
| Right | 888085 |
| Strand | - |
| Nucleotide Sequence | ATGCAAGGGACAGAATTAAGAGAAAAAACAACGGAAGAATTAGAAGCTCTGCTAAAAGAATTAAGGGCAAAATTGGTGAATCTAAAATTTCAGCTTTCCGTGGGTAAGCTGACAGATCATACTGCAATTACAAAGACTAAAAGAGATATTGCACGAGTGCTTACGGTGCTAAGAGAGAGGGGAATAAAGCTATGA |
| Sequence | MQGTELREKTTEELEALLKELRAKLVNLKFQLSVGKLTDHTAITKTKRDIARVLTVLRERGIKL |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl09943. Profile Description: N/A. This family represents the N-terminal region (approximately 8 residues) of the eukaryotic mitochondrial 39-S ribosomal protein L47 (MRP-L47). Mitochondrial ribosomal proteins (MRPs) are the counterparts of the cytoplasmic ribosomal proteins, in that they fulfil similar functions in protein biosynthesis. However, they are distinct in number, features and primary structure. |
| Pubmed ID | |
| Domain | CDD:415815 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | B5Y980 |
| ORF Length (Amino Acid) | 64 |
++ More..
| Conservation Analysis |
No. of Species: 45
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 887891 | 888085 | - | NC_011295.1 | Coprothermobacter proteolyticus DSM 5265 |
| 2 | 993066 | 993266 | + | NZ_CP007389.1 | Thermosipho melanesiensis |
| 3 | 1652487 | 1652675 | - | NZ_CP015519.1 | Syntrophotalea acetylenivorans |
| 4 | 247591 | 247791 | + | NC_014926.1 | Thermovibrio ammonificans HB-1 |
| 5 | 1240138 | 1240338 | + | NC_011653.1 | Thermosipho africanus TCF52B |
| 6 | 344339 | 344569 | + | NZ_CP011546.1 | Corynebacterium uterequi |
| 7 | 474849 | 475079 | + | NZ_LT906467.1 | Corynebacterium imitans |
| 8 | 1145864 | 1146070 | + | NC_012440.1 | Persephonella marina EX-H1 |
| 9 | 1121755 | 1121964 | + | NC_014960.1 | Anaerolinea thermophila UNI-1 |
| 10 | 851472 | 851675 | + | NC_011297.1 | Dictyoglomus thermophilum H-6-12 |
| 11 | 1330544 | 1330744 | + | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 12 | 1306940 | 1307140 | + | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 13 | 1321127 | 1321327 | + | NC_023151.1 | Thermotoga maritima MSB8 |
| 14 | 987158 | 987358 | + | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 15 | 2474859 | 2475089 | - | NZ_CP033896.1 | Corynebacterium choanae |
| 16 | 387327 | 387509 | + | NZ_CP028106.1 | Fusobacterium gonidiaformans ATCC 25563 |
| 17 | 236731 | 236913 | - | NZ_CP028107.1 | Fusobacterium necrophorum subsp. funduliforme |
| 18 | 517629 | 517811 | + | NZ_CP068114.1 | Fusobacterium canifelinum |
| 19 | 1677194 | 1677376 | + | NZ_CP024699.1 | Fusobacterium pseudoperiodonticum |
| 20 | 569262 | 569444 | + | NZ_CP013336.1 | Fusobacterium hwasookii ChDC F206 |
| 21 | 429945 | 430127 | + | NZ_LN831027.1 | Fusobacterium nucleatum subsp. polymorphum |
| 22 | 407882 | 408064 | - | NZ_CP028102.1 | Fusobacterium mortiferum ATCC 9817 |
| 23 | 1132048 | 1132230 | + | NZ_CP028103.1 | Fusobacterium varium ATCC 27725 |
| 24 | 1457085 | 1457267 | + | NZ_CP028105.1 | Fusobacterium ulcerans |
| 25 | 551102 | 551332 | + | NC_021915.1 | Corynebacterium maris DSM 45190 |
| 26 | 540247 | 540477 | + | NZ_CP006764.1 | Corynebacterium doosanense CAU 212 = DSM 45436 |
| 27 | 341536 | 341766 | + | NZ_CP011312.1 | Corynebacterium kutscheri |
| 28 | 2019554 | 2019754 | - | NC_012785.1 | Kosmotoga olearia TBF 19.5.1 |
| 29 | 1018855 | 1019058 | + | NC_011661.1 | Dictyoglomus turgidum DSM 6724 |
| 30 | 1925459 | 1925641 | - | NC_014632.1 | Ilyobacter polytropus DSM 2926 |
| 31 | 433021 | 433251 | + | NC_012590.1 | Corynebacterium aurimucosum ATCC 700975 |
| 32 | 471284 | 471514 | + | NZ_CP010827.1 | Corynebacterium singulare |
| 33 | 2297833 | 2298063 | - | NZ_LS483460.1 | Corynebacterium minutissimum |
| 34 | 2306397 | 2306627 | - | NZ_CP009249.1 | Corynebacterium phocae |
| 35 | 678864 | 679079 | + | NZ_CP036250.1 | Egicoccus halophilus |
| 36 | 777103 | 777333 | - | NZ_CP068161.1 | Corynebacterium propinquum |
| 37 | 464528 | 464758 | + | NZ_CP009246.1 | Corynebacterium flavescens |
| 38 | 428199 | 428429 | + | NZ_CP039247.1 | Corynebacterium endometrii |
| 39 | 1959035 | 1959265 | - | NZ_CP033897.1 | Corynebacterium gerontici |
| 40 | 1618371 | 1618568 | - | NC_012438.1 | Sulfurihydrogenibium azorense Az-Fu1 |
| 41 | 1445880 | 1446080 | - | NC_017095.1 | Fervidobacterium pennivorans DSM 9078 |
| 42 | 1488079 | 1488279 | - | NZ_CP014334.1 | Fervidobacterium islandicum |
| 43 | 1540179 | 1540394 | - | NC_015389.1 | Coriobacterium glomerans PW2 |
| 44 | 857433 | 857621 | + | NC_007498.2 | Syntrophotalea carbinolica DSM 2380 |
| 45 | 1696200 | 1696400 | + | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_011295.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00253.23 | 0.67 | 30 | 1623.5 | same-strand | Ribosomal protein S14p/S29e |
| 2 | PF00673.23 | 0.71 | 32 | 1059.5 | same-strand | ribosomal L5P family C-terminus |
| 3 | PF00281.21 | 0.71 | 32 | 1059.5 | same-strand | Ribosomal protein L5 |
| 4 | PF17136.6 | 0.71 | 32 | 709.0 | same-strand | Ribosomal proteins 50S L24/mitochondrial 39S L24 |
| 5 | PF00467.31 | 0.69 | 31 | 709 | same-strand | KOW motif |
| 6 | PF00238.21 | 0.73 | 33 | 325 | same-strand | Ribosomal protein L14p/L23e |
| 7 | PF00366.22 | 1.0 | 45 | 6 | same-strand | Ribosomal protein S17 |
| 8 | PF00252.20 | 1.0 | 45 | 0 | same-strand | Ribosomal protein L16p/L10e |
| 9 | PF00189.22 | 1.0 | 45 | 428 | same-strand | Ribosomal protein S3, C-terminal domain |
| 10 | PF07650.19 | 1.0 | 45 | 428 | same-strand | KH domain |
| 11 | PF00237.21 | 1.0 | 45 | 1146 | same-strand | Ribosomal protein L22p/L17e |
| 12 | PF00203.23 | 1.0 | 45 | 1528 | same-strand | Ribosomal protein S19 |
| 13 | PF03947.20 | 1.0 | 45 | 1822 | same-strand | Ribosomal Proteins L2, C-terminal domain |
| 14 | PF00181.25 | 1.0 | 45 | 1822 | same-strand | Ribosomal Proteins L2, RNA binding domain |
++ More..