Result : EXP02554
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02554 |
| NCBI Accession ID | |
| Organism | Streptococcus |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGAAAAAAGTGTTTTTCAAAACTAGTCTTGGAATCACACTTAGCGTCCTAGCTAGTGTCTTATTCCTTGCCCACAAATCTGAATTCTTCAAGGACGATAGTGCCTTATATGATGAATTTGATTCTACGTTGGATTAA |
| Sequence | MKKVFFKTSLGITLSVLASVLFLAHKSEFFKDDSALYDEFDSTLD |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 45 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 223414 | 223551 | - | NZ_CP029491.1 | Streptococcus sobrinus |
| 2 | 1163142 | 1163270 | + | NZ_CP017713.1 | Loigolactobacillus coryniformis subsp. coryniformis KCTC 3167 = DSM 20001 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP029491.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06100.13 | 1.0 | 2 | 146.0 | same-strand | MCRA family |
++ More..