Result : A1ATL2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) (EC 6.3.5.-) |
| NCBI Accession ID | CP000482.1 |
| Organism | Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1) |
| Left | 3376314 |
| Right | 3376601 |
| Strand | + |
| Nucleotide Sequence | ATGAAGATTACCATCGCCGATGTGGAACACGTTGCCCGCCTGGCCAGACTGGAACTGAGCGACGAAGAGAAGCAACTCTTTGCCGGTCAGATGGACACCATCCTCGGCTATGTCGATAAGCTGAAGGAGCTGAATACCGACGGCATTCAGCCCACCTCCCACGCCGTCCCCATGGAGAACGCCTTCCGGGAGGACCAGACCCGCCCATCCATCGGCACCGCGAAGGCCCTGGCCAATGCGCCGGATCCGGTTCTGGGGTTCTTCCGCGTCCCTAAGGTTATCGAATAA |
| Sequence | MKITIADVEHVARLARLELSDEEKQLFAGQMDTILGYVDKLKELNTDGIQPTSHAVPMENAFREDQTRPSIGTAKALANAPDPVLGFFRVPKVIE |
| Source of smORF | Swiss-Prot |
| Function | Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_00122}. |
| Pubmed ID | |
| Domain | CDD:412411 |
| Functional Category | Others |
| Uniprot ID | A1ATL2 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 79
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3376314 | 3376601 | + | NC_008609.1 | Pelobacter propionicus DSM 2379 |
| 2 | 3718972 | 3719259 | - | NC_002939.5 | Geobacter sulfurreducens PCA |
| 3 | 93142 | 93429 | - | NC_007517.1 | Geobacter metallireducens GS-15 |
| 4 | 4999804 | 5000091 | - | NC_009483.1 | Geobacter uraniireducens Rf4 |
| 5 | 92555 | 92842 | - | NZ_CP009788.1 | Geobacter pickeringii |
| 6 | 450751 | 451038 | + | NC_011979.1 | Geobacter daltonii FRC-32 |
| 7 | 4167556 | 4167843 | + | NC_011146.1 | Citrifermentans bemidjiense Bem |
| 8 | 3409400 | 3409687 | + | NC_010814.1 | Geobacter lovleyi SZ |
| 9 | 683775 | 684062 | - | NZ_CP010802.1 | Desulfuromonas soudanensis |
| 10 | 4068413 | 4068700 | + | NZ_AP023213.1 | Citrifermentans bremense |
| 11 | 3152366 | 3152653 | - | NZ_CP015519.1 | Syntrophotalea acetylenivorans |
| 12 | 455926 | 456213 | + | NZ_CP010311.1 | Geoalkalibacter subterraneus |
| 13 | 716158 | 716445 | - | NZ_CP011058.1 | Paenibacillus beijingensis |
| 14 | 5693287 | 5693574 | - | NZ_CP048209.1 | Paenibacillus lycopersici |
| 15 | 6312360 | 6312647 | - | NZ_CP034437.1 | Paenibacillus albus |
| 16 | 204337 | 204624 | + | NZ_CP033433.1 | Cohnella candidum |
| 17 | 6801367 | 6801654 | + | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 18 | 2527914 | 2528201 | + | NC_007498.2 | Syntrophotalea carbinolica DSM 2380 |
| 19 | 1966331 | 1966618 | - | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 20 | 5188740 | 5189027 | - | NZ_AP019400.1 | Cohnella abietis |
| 21 | 6583050 | 6583337 | + | NZ_CP045293.1 | Paenibacillus guangzhouensis |
| 22 | 3153158 | 3153448 | - | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 23 | 4795478 | 4795765 | + | NZ_CP048286.1 | Paenibacillus rhizovicinus |
| 24 | 2245720 | 2246004 | - | NZ_CP046996.1 | Dehalobacter restrictus |
| 25 | 735920 | 736207 | - | NZ_AP022873.1 | Dissulfurispira thermophila |
| 26 | 976711 | 976995 | + | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 27 | 3462722 | 3463009 | - | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 28 | 697205 | 697492 | + | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 29 | 1365709 | 1365996 | + | NZ_CP034235.1 | Paenibacillus psychroresistens |
| 30 | 2911633 | 2911920 | - | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 31 | 684710 | 684997 | + | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 32 | 642064 | 642351 | + | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 33 | 657776 | 658066 | + | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 34 | 1617403 | 1617687 | + | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 35 | 4964716 | 4965003 | - | NZ_CP013023.1 | Paenibacillus bovis |
| 36 | 1059483 | 1059770 | + | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 37 | 2084303 | 2084590 | - | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 38 | 2976270 | 2976557 | - | NC_007759.1 | Syntrophus aciditrophicus SB |
| 39 | 1428155 | 1428439 | + | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
| 40 | 6563837 | 6564124 | + | NZ_CP061799.1 | Desulfonema limicola |
| 41 | 774216 | 774503 | + | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 42 | 4028023 | 4028313 | - | NC_016584.1 | Desulfosporosinus orientis DSM 765 |
| 43 | 4199797 | 4200084 | + | NZ_CP016809.1 | Paenibacillus ihbetae |
| 44 | 2499000 | 2499236 | - | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 45 | 1721936 | 1722223 | - | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 46 | 584357 | 584644 | + | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 47 | 719434 | 719721 | + | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 48 | 3167552 | 3167842 | - | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 49 | 3047483 | 3047770 | - | NC_019897.1 | Thermobacillus composti KWC4 |
| 50 | 713911 | 714195 | + | NC_015172.1 | Syntrophobotulus glycolicus DSM 8271 |
| 51 | 939521 | 939805 | + | NZ_CP007032.1 | Desulfitobacterium metallireducens DSM 15288 |
| 52 | 5726803 | 5727090 | - | NZ_CP026520.1 | Paenibacillus chitinolyticus |
| 53 | 1300744 | 1301028 | + | NC_019903.1 | Desulfitobacterium dichloroeliminans LMG P-21439 |
| 54 | 2997842 | 2998144 | + | NZ_CP053564.1 | Pseudonocardia broussonetiae |
| 55 | 4786412 | 4786699 | - | NZ_CP009286.1 | Paenibacillus stellifer |
| 56 | 569306 | 569596 | + | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 57 | 4668659 | 4668946 | + | NZ_CP061800.1 | Desulfonema magnum |
| 58 | 551541 | 551828 | - | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
| 59 | 4280374 | 4280673 | + | NZ_CP016793.1 | Lentzea guizhouensis |
| 60 | 1221657 | 1221941 | - | NC_020304.1 | Desulfocapsa sulfexigens DSM 10523 |
| 61 | 2260877 | 2261167 | - | NZ_CP034118.1 | Staphylospora marina |
| 62 | 4670155 | 4670439 | - | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 63 | 2347892 | 2348179 | - | NZ_CP035492.1 | Paenibacillus protaetiae |
| 64 | 7993887 | 7994186 | - | NC_019673.1 | Saccharothrix espanaensis DSM 44229 |
| 65 | 5663635 | 5663958 | - | NZ_AP018920.1 | Pseudonocardia autotrophica |
| 66 | 74027 | 74317 | - | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 67 | 2037720 | 2037962 | - | NC_014654.1 | Halanaerobium hydrogeniformans |
| 68 | 238797 | 239066 | + | NC_011899.1 | Halothermothrix orenii H 168 |
| 69 | 6948104 | 6948403 | - | NZ_CP023445.1 | Actinosynnema pretiosum |
| 70 | 3930074 | 3930358 | - | NZ_AP021875.1 | Desulfosarcina widdelii |
| 71 | 2250281 | 2250571 | + | NZ_CP048877.1 | Thermosulfuriphilus ammonigenes |
| 72 | 3921775 | 3922059 | - | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 73 | 9628468 | 9628767 | - | NZ_CP034550.1 | Saccharothrix syringae |
| 74 | 3802034 | 3802321 | + | NC_014972.1 | Desulfobulbus propionicus DSM 2032 |
| 75 | 7087156 | 7087455 | - | NC_013093.1 | Actinosynnema mirum DSM 43827 |
| 76 | 147926 | 148213 | - | NZ_CP011388.1 | Paenibacillus swuensis |
| 77 | 2561295 | 2561531 | - | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 78 | 2494227 | 2494517 | - | NZ_CP036291.1 | Pirellulimonas nuda |
| 79 | 1109404 | 1109667 | + | NC_013385.1 | Ammonifex degensii KC4 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_008609.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01425.23 | 0.99 | 78 | 30.0 | same-strand | Amidase |
| 2 | PF02934.17 | 0.86 | 68 | 1514.0 | same-strand | GatB/GatE catalytic domain |
| 3 | PF02637.20 | 0.86 | 68 | 1514.0 | same-strand | GatB domain |
++ More..