Protein name |
Immunity protein CdiI-1 (CdiI-EC869) |
NCBI Accession ID |
ABHU01000020.1 |
Organism |
Escherichia coli O157:H7 (strain EC869) |
Left |
37020 |
Right |
37280 |
Strand |
+ |
Nucleotide Sequence |
GTGAATACAAAACTGTGGAGCCACTCAGAAAGTGATGATTTTAGTCGTCGTTTTGTTGACGATTTTAGCCTTGATATTGAGGTGATTATATCATCAGAGTCTATGTTATTAACGATTGGAGAGAATAAAAAGGTAACTAGCTGGATAAAATGTAGCGATAATTTTTATCTCGGGATAGATGCAGGAAGAAATGTCGTTCATTTGTATTTGGATAAGTTAACACCAAGTGAAGTGGAAAGTTTTTTTGAGGCAGTAGGTTAG |
Sequence |
MNTKLWSHSESDDFSRRFVDDFSLDIEVIISSESMLLTIGENKKVTSWIKCSDNFYLGIDAGRNVVHLYLDKLTPSEVESFFEAVG |
Source of smORF |
Swiss-Prot |
Function |
Immunity protein component of a toxin-immunity protein module, which functions as a cellular contact-dependent growth inhibition (CDI) system. CDI modules allow bacteria to communicate with and inhibit the growth of closely related neighboring bacteria in a contact-dependent fashion. Neutralizes the toxic activity of cognate toxin CdiA-EC869 (the C-terminal 289 residue CT fragment). Does not inhibit toxic activity of CdiA from other toxin-immunity modules or strains of E.coli. {ECO:0000269|Pubmed:28223500}. |
Pubmed ID |
21421787
28223500
|
Domain |
|
Functional Category |
Others |
Uniprot ID |
A0A0H3PIP6
|
ORF Length (Amino Acid) |
86 |