Protein Information |
Information Type | Description |
---|---|
Protein name | EXP02538 |
NCBI Accession ID | |
Organism | Enterococcus |
Left | |
Right | |
Strand | |
Nucleotide Sequence | ATGAGCAAGTATTGTCTATTTTTAATAGTTATCTATTATTTAACGGGAGGAAATAATTCTATGAGTCGCTTTTGTAAATTTGGAAAGTTACACGTTACTAAAGGGAATGTAGATAAATTATTAGGTATAGGGCACCTCTAA |
Sequence | MSKYCLFLIVIYYLTGGNNSMSRFCKFGKLHVTKGNVDKLLGIGHL |
Source of smORF | Metagenomic Ribo-seq |
Function | |
Pubmed ID | 32601270 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 46 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 752069 | 752194 | + | NZ_AP019309.1 | Intestinibaculum porci |
2 | 735650 | 735775 | - | NZ_CP018888.1 | Amylolactobacillus amylophilus DSM 20533 = JCM 1125 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00398.22 | 1.0 | 2 | -55.0 | same-strand | Ribosomal RNA adenine dimethylase |
2 | PF13649.8 | 1.0 | 2 | -55.0 | same-strand | Methyltransferase domain |