Result : B5RRG3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L28 |
| NCBI Accession ID | CP000993.1 |
| Organism | Borrelia recurrentis (strain A1) |
| Left | 381286 |
| Right | 381564 |
| Strand | - |
| Nucleotide Sequence | ATGGGGAGAGAATGTGAAATTACAGGAAAAAGGACAATGTTTGGGAATAATGTTCCACGAAAGGGACTTGCCAAAAAGAAAGGTGGAGCAGGACAACATATTGGTGTTAAGACTAAGAGAACTTTTAAGGTTAATTTAATAAATAAGAAATTTTTTATTCCAGAACTTGGGAAAAATGTTAGTATTAAGATTTCTGCAAGTACTTTAAGAAGTATTTCAAAAGTAGGTTTGAATGTTTTTTTAAAGAAAAATAATAAAAAAATTGATGATTTCATTTAA |
| Sequence | MGRECEITGKRTMFGNNVPRKGLAKKKGGAGQHIGVKTKRTFKVNLINKKFFIPELGKNVSIKISASTLRSISKVGLNVFLKKNNKKIDDFI |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00367. Profile Description: Ribosomal L28 family. This model describes bacterial and chloroplast forms of the 50S ribosomal protein L28, a polypeptide about 60 amino acids in length. Mitochondrial homologs differ substantially in architecture (e.g. SP|P36525 from Saccharomyces cerevisiae, which is 258 amino acids long) and are not included. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 18787695 |
| Domain | CDD:412338 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | B5RRG3 |
| ORF Length (Amino Acid) | 92 |
++ More..
| Conservation Analysis |
No. of Species: 11
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 381286 | 381564 | - | NC_011244.1 | Borrelia recurrentis A1 |
| 2 | 362587 | 362865 | - | NZ_CP011060.1 | Borrelia hermsii CC1 |
| 3 | 361115 | 361393 | - | NZ_CP007022.1 | Borrelia parkeri HR1 |
| 4 | 354991 | 355269 | - | NZ_CP013704.1 | Borrelia anserina Es |
| 5 | 361231 | 361509 | - | NC_008710.1 | Borrelia turicatae 91E135 |
| 6 | 372099 | 372377 | - | NZ_CP028884.1 | Borrelia turcica IST7 |
| 7 | 545739 | 546017 | + | NZ_CP024333.1 | Borrelia miyamotoi |
| 8 | 358706 | 358984 | - | NZ_CP028861.1 | Borreliella garinii |
| 9 | 357682 | 357960 | - | NC_015921.1 | Borreliella bissettii DN127 |
| 10 | 357817 | 358095 | - | NZ_CP044535.1 | Borrelia maritima |
| 11 | 360019 | 360297 | - | NZ_CP015796.1 | Borreliella mayonii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_011244.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13413.8 | 1.0 | 11 | 4563 | same-strand | Helix-turn-helix domain |
| 2 | PF12844.9 | 1.0 | 11 | 4563 | same-strand | Helix-turn-helix domain |
| 3 | PF03548.17 | 0.64 | 7 | 3916 | same-strand | Outer membrane lipoprotein carrier protein LolA |
| 4 | PF05670.15 | 1.0 | 11 | 2313 | opposite-strand | NFACT protein RNA binding domain |
| 5 | PF00224.23 | 1.0 | 11 | 777 | opposite-strand | Pyruvate kinase, barrel domain |
| 6 | PF02887.18 | 1.0 | 11 | 777 | opposite-strand | Pyruvate kinase, alpha/beta domain |
| 7 | PF02559.18 | 0.64 | 7 | 5592 | same-strand | CarD-like/TRCF domain |
++ More..