Protein Information |
Information Type | Description |
---|---|
Protein name | EXP02528 |
NCBI Accession ID | |
Organism | Aggregatibacter,Pasteurella,Kingella,Cardiobacterium |
Left | |
Right | |
Strand | |
Nucleotide Sequence | ATGGCAGGCGTCAACAAAGTCATACTCATCGGCAACCTGGGCAACGACCCGGACATGCGCTACATGCCCAACGGCGAACCGGTGGCCAACATCTCCATCGCCACCAGTGAGACCTGGAAGATCGGAAGAGCACACGTCTGA |
Sequence | MAGVNKVILIGNLGNDPDMRYMPNGEPVANISIATSETWKIGRAHV |
Source of smORF | Metagenomic Ribo-seq |
Function | |
Pubmed ID | 32601270 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 46 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3029322 | 3029465 | - | NZ_CP007445.1 | Gilliamella apicola |
2 | 333150 | 333284 | + | NC_012779.2 | Edwardsiella ictaluri 93-146 |
3 | 84696 | 84845 | - | NZ_CP011809.2 | Pandoraea faecigallinarum |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF08900.13 | 0.67 | 2 | 2102.0 | same-strand | Transcriptional regulator AcaB |