Result : EXP02528
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02528 |
| NCBI Accession ID | |
| Organism | Aggregatibacter,Pasteurella,Kingella,Cardiobacterium |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGGCAGGCGTCAACAAAGTCATACTCATCGGCAACCTGGGCAACGACCCGGACATGCGCTACATGCCCAACGGCGAACCGGTGGCCAACATCTCCATCGCCACCAGTGAGACCTGGAAGATCGGAAGAGCACACGTCTGA |
| Sequence | MAGVNKVILIGNLGNDPDMRYMPNGEPVANISIATSETWKIGRAHV |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 46 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3029322 | 3029465 | - | NZ_CP007445.1 | Gilliamella apicola |
| 2 | 333150 | 333284 | + | NC_012779.2 | Edwardsiella ictaluri 93-146 |
| 3 | 84696 | 84845 | - | NZ_CP011809.2 | Pandoraea faecigallinarum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP007445.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF08900.13 | 0.67 | 2 | 2102.0 | same-strand | Transcriptional regulator AcaB |
++ More..