Result : EXP02525
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02525 |
| NCBI Accession ID | |
| Organism | |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGAGTGCCGGACAAATGGTTGAAGACGTACGGTTGGCTGTCAACGGAAGAGTGAAAGTAGATTTCTACGGCCGTATGGGTGGTGTTGTACCTACTCCGGAAGAGATCGTGGAAGCACTGAAAAATAAATTTAAGATTTAA |
| Sequence | MSAGQMVEDVRLAVNGRVKVDFYGRMGGVVPTPEEIVEALKNKFKI |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 46 |
++ More..
| Conservation Analysis |
No. of Species: 167
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3808062 | 3808202 | - | NZ_LT906459.1 | Odoribacter splanchnicus |
| 2 | 634367 | 634510 | - | NC_014734.1 | Paludibacter propionicigenes WB4 |
| 3 | 3398846 | 3398989 | + | NZ_AP018042.1 | Labilibaculum antarcticum |
| 4 | 2159003 | 2159149 | - | NZ_CP011232.1 | Kosmotoga pacifica |
| 5 | 2660216 | 2660365 | + | NC_018178.1 | Melioribacter roseus P3M-2 |
| 6 | 395133 | 395255 | + | NZ_CP007034.1 | Barnesiella viscericola DSM 18177 |
| 7 | 1911313 | 1911438 | - | NZ_LN877293.1 | Bacteroides fragilis |
| 8 | 3417787 | 3417924 | + | NC_014933.1 | Bacteroides helcogenes P 36-108 |
| 9 | 940371 | 940508 | + | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 10 | 243706 | 243831 | - | NZ_CP012938.1 | Bacteroides ovatus |
| 11 | 1573310 | 1573435 | - | NZ_CP015401.2 | Bacteroides caecimuris |
| 12 | 1193852 | 1193980 | + | NZ_CP027234.1 | Bacteroides heparinolyticus |
| 13 | 1433332 | 1433475 | - | NZ_CP041345.1 | Tenuifilum thalassicum |
| 14 | 2658790 | 2658915 | - | NZ_CP027231.1 | Bacteroides zoogleoformans |
| 15 | 200711 | 200845 | - | NZ_AP018712.1 | Tepiditoga spiralis |
| 16 | 1917769 | 1917912 | - | NZ_CP016379.1 | Anoxybacter fermentans |
| 17 | 1832105 | 1832248 | - | NC_009828.1 | Pseudothermotoga lettingae TMO |
| 18 | 3975095 | 3975235 | - | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
| 19 | 2165903 | 2166019 | + | NZ_CP013195.1 | Prevotella enoeca |
| 20 | 1160994 | 1161110 | + | NZ_LT608328.1 | Petrimonas mucosa |
| 21 | 1610617 | 1610757 | + | NZ_LS483447.1 | Porphyromonas crevioricanis |
| 22 | 900145 | 900267 | + | NZ_LT605205.1 | Proteiniphilum saccharofermentans |
| 23 | 984567 | 984710 | + | NZ_AP014510.1 | Thermotoga profunda AZM34c06 |
| 24 | 1073957 | 1074100 | + | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 25 | 435426 | 435569 | + | NZ_CP013118.1 | Salinivirga cyanobacteriivorans |
| 26 | 2910419 | 2910541 | - | NZ_CP045696.1 | Sodaliphilus pleomorphus |
| 27 | 1618956 | 1619093 | + | NZ_AP019551.1 | Athalassotoga saccharophila |
| 28 | 394495 | 394638 | - | NZ_CP021904.1 | Alkalitalea saponilacus |
| 29 | 2104635 | 2104772 | + | NZ_CP054012.1 | Parabacteroides distasonis |
| 30 | 1704260 | 1704373 | + | NZ_CP024727.1 | Prevotella intermedia |
| 31 | 1095586 | 1095729 | - | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 32 | 1080113 | 1080256 | - | NC_023151.1 | Thermotoga maritima MSB8 |
| 33 | 2067172 | 2067315 | + | NZ_CP032819.1 | Butyricimonas faecalis |
| 34 | 2975677 | 2975826 | - | NZ_AP023049.1 | Alistipes indistinctus |
| 35 | 154071 | 154205 | + | NC_016751.1 | Marinitoga piezophila KA3 |
| 36 | 1210894 | 1211007 | - | NC_014370.1 | Prevotella melaninogenica ATCC 25845 |
| 37 | 1321384 | 1321509 | - | NZ_CP023863.1 | Prevotella jejuni |
| 38 | 364387 | 364527 | + | NC_017095.1 | Fervidobacterium pennivorans DSM 9078 |
| 39 | 246166 | 246312 | + | NC_006177.1 | Symbiobacterium thermophilum IAM 14863 |
| 40 | 2106664 | 2106780 | - | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 41 | 2291687 | 2291833 | - | NC_012785.1 | Kosmotoga olearia TBF 19.5.1 |
| 42 | 1867245 | 1867388 | - | NC_022792.1 | Pseudothermotoga elfii DSM 9442 = NBRC 107921 |
| 43 | 1967726 | 1967851 | + | NC_010729.1 | Porphyromonas gingivalis ATCC 33277 |
| 44 | 2721718 | 2721864 | - | NZ_CP020953.1 | Clostridium drakei |
| 45 | 5237933 | 5238079 | - | NZ_CP020953.1 | Clostridium drakei |
| 46 | 1355641 | 1355763 | - | NC_014033.1 | Prevotella ruminicola 23 |
| 47 | 1477035 | 1477181 | + | NZ_CP009933.1 | Clostridium scatologenes |
| 48 | 4684306 | 4684452 | + | NZ_CP009933.1 | Clostridium scatologenes |
| 49 | 1038019 | 1038141 | + | NZ_LR215980.1 | Paraprevotella xylaniphila YIT 11841 |
| 50 | 1634015 | 1634158 | - | NZ_CP069450.1 | Butyricimonas virosa |
| 51 | 4388901 | 4389047 | - | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 52 | 1755408 | 1755554 | - | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 53 | 435761 | 435901 | + | NZ_CP014334.1 | Fervidobacterium islandicum |
| 54 | 896463 | 896585 | - | NZ_CP012074.1 | Prevotella fusca JCM 17724 |
| 55 | 114826 | 114966 | + | NC_009718.1 | Fervidobacterium nodosum Rt17-B1 |
| 56 | 1864160 | 1864309 | + | NC_015707.1 | Pseudothermotoga thermarum DSM 5069 |
| 57 | 2169484 | 2169606 | - | NC_014365.1 | Desulfarculus baarsii DSM 2075 |
| 58 | 1425132 | 1425281 | - | NC_022567.1 | Adlercreutzia equolifaciens DSM 19450 |
| 59 | 2100025 | 2100171 | - | NZ_CP036259.1 | Sporomusa termitida |
| 60 | 212982 | 213116 | + | NZ_CP036259.1 | Sporomusa termitida |
| 61 | 200888 | 201022 | - | NZ_LS974202.1 | Mesotoga infera |
| 62 | 705550 | 705681 | + | NZ_CP014176.1 | Clostridium argentinense |
| 63 | 2987488 | 2987628 | - | NC_009614.1 | Phocaeicola vulgatus ATCC 8482 |
| 64 | 3128999 | 3129139 | - | NZ_LR699004.1 | Phocaeicola dorei |
| 65 | 736423 | 736566 | + | NC_011899.1 | Halothermothrix orenii H 168 |
| 66 | 635739 | 635852 | + | NZ_LR134506.1 | Porphyromonas cangingivalis |
| 67 | 847559 | 847702 | + | NZ_LR698974.1 | Candidatus Methanomassiliicoccus intestinalis |
| 68 | 640110 | 640223 | + | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 69 | 1491207 | 1491353 | - | NC_017455.1 | Halanaerobium praevalens DSM 2228 |
| 70 | 1590158 | 1590292 | + | NC_010003.1 | Petrotoga mobilis SJ95 |
| 71 | 4980786 | 4980935 | - | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 72 | 106180 | 106320 | - | NZ_CP007389.1 | Thermosipho melanesiensis |
| 73 | 1703853 | 1703978 | - | NC_015501.1 | Porphyromonas asaccharolytica DSM 20707 |
| 74 | 8331107 | 8331241 | - | NZ_CP063849.1 | Paludibaculum fermentans |
| 75 | 3915417 | 3915563 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 76 | 3634253 | 3634399 | - | NZ_CP028842.1 | Clostridium botulinum |
| 77 | 3045033 | 3045161 | - | NZ_AP019735.1 | Alistipes communis |
| 78 | 2508056 | 2508199 | + | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 79 | 339755 | 339895 | - | NC_011653.1 | Thermosipho africanus TCF52B |
| 80 | 2933840 | 2933956 | - | NZ_AP019736.1 | Alistipes dispar |
| 81 | 1975044 | 1975199 | - | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 82 | 1944613 | 1944759 | - | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 83 | 829972 | 830115 | + | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 84 | 1718185 | 1718304 | + | NZ_CP025197.1 | Acetivibrio saccincola |
| 85 | 399504 | 399644 | - | NZ_LR134523.1 | Peptoniphilus ivorii |
| 86 | 3733166 | 3733312 | + | NZ_CP018099.1 | Caldithrix abyssi DSM 13497 |
| 87 | 1552941 | 1553081 | + | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 88 | 1752548 | 1752694 | - | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 89 | 2943417 | 2943542 | - | NZ_CP061336.1 | Ruminiclostridium herbifermentans |
| 90 | 273617 | 273760 | + | NZ_CP029256.1 | Christensenella minuta |
| 91 | 1602709 | 1602834 | + | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 92 | 3992451 | 3992597 | + | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 93 | 1457709 | 1457846 | + | NC_017934.1 | Mesotoga prima MesG1.Ag.4.2 |
| 94 | 394776 | 394919 | + | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 95 | 1679528 | 1679671 | - | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 96 | 1094339 | 1094482 | + | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 97 | 2216528 | 2216671 | - | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 98 | 150936 | 151061 | - | NC_015164.1 | Phocaeicola salanitronis DSM 18170 |
| 99 | 389699 | 389830 | + | NZ_LR134384.1 | Prevotella oris |
| 100 | 737452 | 737577 | - | NZ_CP069440.1 | Phocaeicola coprophilus |
| 101 | 1882202 | 1882348 | - | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 102 | 1711357 | 1711491 | - | NZ_LN824141.1 | Defluviitoga tunisiensis |
| 103 | 474702 | 474848 | + | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 104 | 755399 | 755536 | + | NC_018024.1 | Acetomicrobium mobile DSM 13181 |
| 105 | 195562 | 195705 | + | NC_017096.1 | Caldisericum exile AZM16c01 |
| 106 | 1354214 | 1354369 | + | NC_020134.1 | Thermoclostridium stercorarium subsp. stercorarium DSM 8532 |
| 107 | 312784 | 312930 | + | NZ_CP032416.1 | Clostridium fermenticellae |
| 108 | 624823 | 624963 | - | NC_013522.1 | Thermanaerovibrio acidaminovorans DSM 6589 |
| 109 | 1842052 | 1842174 | - | NC_014220.1 | Syntrophothermus lipocalidus DSM 12680 |
| 110 | 2494543 | 2494659 | + | NZ_LR027382.1 | Alistipes megaguti |
| 111 | 1387650 | 1387793 | - | NC_013385.1 | Ammonifex degensii KC4 |
| 112 | 472283 | 472402 | - | NZ_AP022873.1 | Dissulfurispira thermophila |
| 113 | 1308382 | 1308519 | - | NZ_AP021875.1 | Desulfosarcina widdelii |
| 114 | 4415782 | 4415928 | - | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 115 | 3698766 | 3698894 | - | NC_018011.1 | Alistipes finegoldii DSM 17242 |
| 116 | 3093923 | 3094057 | + | NZ_CP035807.1 | Thiospirochaeta perfilievii |
| 117 | 1029087 | 1029212 | + | NZ_CP013355.1 | Lutibacter profundi |
| 118 | 3709553 | 3709699 | - | NZ_CP009687.1 | Clostridium aceticum |
| 119 | 1875943 | 1876092 | + | NZ_LR134379.1 | Slackia heliotrinireducens |
| 120 | 4066358 | 4066504 | - | NZ_CP020559.1 | Clostridium formicaceticum |
| 121 | 126561 | 126707 | + | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 122 | 1860282 | 1860425 | - | NZ_AP014509.1 | Thermotoga caldifontis AZM44c09 |
| 123 | 524205 | 524342 | + | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 124 | 649103 | 649219 | - | NZ_CP015402.2 | Muribaculum intestinale |
| 125 | 4094601 | 4094753 | + | NZ_AP018449.1 | Methylomusa anaerophila |
| 126 | 1228312 | 1228455 | + | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
| 127 | 2585812 | 2585958 | - | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 128 | 4655806 | 4655949 | + | NZ_CP061800.1 | Desulfonema magnum |
| 129 | 2091369 | 2091500 | + | NZ_CP034413.2 | Dysosmobacter welbionis |
| 130 | 849625 | 849759 | - | NC_018645.1 | Desulfobacula toluolica Tol2 |
| 131 | 2894583 | 2894702 | + | NC_011768.1 | Desulfatibacillum aliphaticivorans |
| 132 | 5920736 | 5920870 | - | NZ_CP061799.1 | Desulfonema limicola |
| 133 | 1420735 | 1420884 | - | NZ_CP011402.1 | Denitrobacterium detoxificans |
| 134 | 1014431 | 1014577 | + | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 135 | 903885 | 904031 | - | NC_013170.1 | Cryptobacterium curtum DSM 15641 |
| 136 | 678742 | 678873 | - | NZ_CP015519.1 | Syntrophotalea acetylenivorans |
| 137 | 618158 | 618280 | - | NZ_CP015519.1 | Syntrophotalea acetylenivorans |
| 138 | 3113811 | 3113960 | - | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 139 | 433866 | 433994 | - | NZ_CP009498.1 | Endomicrobium proavitum |
| 140 | 1915838 | 1915969 | - | NZ_CP019914.1 | Brachyspira hampsonii |
| 141 | 1782683 | 1782832 | - | NZ_CP035130.1 | Gudongella oleilytica |
| 142 | 2010591 | 2010722 | + | NZ_CP046932.1 | Brachyspira hyodysenteriae |
| 143 | 1766917 | 1767054 | - | NC_014720.1 | Caldicellulosiruptor kronotskyensis 2002 |
| 144 | 2622118 | 2622267 | - | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 145 | 368964 | 369110 | + | NC_015499.1 | Thermodesulfobium narugense DSM 14796 |
| 146 | 2988483 | 2988623 | - | NC_015732.1 | Treponema caldarium DSM 7334 |
| 147 | 343151 | 343297 | + | NZ_CP020921.1 | Thermodesulfobium acidiphilum |
| 148 | 1189591 | 1189728 | + | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
| 149 | 1146864 | 1147001 | + | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
| 150 | 3116316 | 3116447 | - | NC_017243.1 | Brachyspira intermedia PWS/A |
| 151 | 1545772 | 1545909 | - | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
| 152 | 2031278 | 2031430 | - | NZ_CP007032.1 | Desulfitobacterium metallireducens DSM 15288 |
| 153 | 1673495 | 1673632 | - | NC_014652.1 | Caldicellulosiruptor hydrothermalis 108 |
| 154 | 1002588 | 1002725 | + | NC_014657.1 | Caldicellulosiruptor owensensis OL |
| 155 | 638052 | 638189 | + | NC_014364.1 | Sediminispirochaeta smaragdinae DSM 11293 |
| 156 | 576680 | 576817 | + | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
| 157 | 3284964 | 3285077 | - | NC_011979.1 | Geobacter daltonii FRC-32 |
| 158 | 1904095 | 1904214 | + | NZ_CP010802.1 | Desulfuromonas soudanensis |
| 159 | 1708717 | 1708854 | + | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 160 | 1751085 | 1751222 | - | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
| 161 | 1469652 | 1469777 | + | NC_007517.1 | Geobacter metallireducens GS-15 |
| 162 | 2230006 | 2230152 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 163 | 1899187 | 1899333 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 164 | 1964672 | 1964818 | - | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 165 | 488812 | 488958 | + | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 166 | 1858902 | 1859048 | - | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 167 | 1219950 | 1220075 | + | NC_012108.1 | Desulfobacterium autotrophicum HRM2 |
| 168 | 3588378 | 3588497 | + | NC_016048.1 | Oscillibacter valericigenes Sjm18-20 |
| 169 | 909561 | 909695 | + | NC_022549.1 | Acholeplasma brassicae |
| 170 | 2038459 | 2038584 | - | NC_002939.5 | Geobacter sulfurreducens PCA |
| 171 | 1377804 | 1377950 | + | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 172 | 2108372 | 2108518 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 173 | 2475084 | 2475206 | - | NC_010814.1 | Geobacter lovleyi SZ |
| 174 | 35965 | 36078 | + | NC_007519.1 | Desulfovibrio alaskensis G20 |
| 175 | 605691 | 605831 | + | NC_013939.1 | Deferribacter desulfuricans SSM1 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LT906459.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01558.20 | 0.99 | 166 | 767.0 | same-strand | Pyruvate ferredoxin/flavodoxin oxidoreductase |
| 2 | PF02775.23 | 0.99 | 165 | 4.0 | same-strand | Thiamine pyrophosphate enzyme, C-terminal TPP binding domain |
| 3 | PF00037.29 | 0.93 | 155 | 941 | same-strand | 4Fe-4S binding domain |
| 4 | PF12838.9 | 0.97 | 162 | 941 | same-strand | 4Fe-4S dicluster domain |
| 5 | PF12797.9 | 0.93 | 156 | 941.0 | same-strand | 4Fe-4S binding domain |
| 6 | PF13187.8 | 0.95 | 159 | 941.0 | same-strand | 4Fe-4S dicluster domain |
| 7 | PF13237.8 | 0.93 | 156 | 941 | same-strand | 4Fe-4S dicluster domain |
| 8 | PF12837.9 | 0.83 | 139 | 941 | same-strand | 4Fe-4S binding domain |
++ More..