Result : EXP02520
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02520 |
| NCBI Accession ID | |
| Organism | Paraprevotella |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGTCCGACAAGGTGTTGCAGAATCTTTGTGAGGCTCGTCCGCAAACAGTGGAGGCATTCGGTACGGTCAGCGGCATCGGTGAGTTCAAAAAAGAAAAGTACGGGAAAGACTTTGTGGAAGTGATTCGCCGTTTCAAGTGA |
| Sequence | MSDKVLQNLCEARPQTVEAFGTVSGIGEFKKEKYGKDFVEVIRRFK |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 46 |
++ More..
| Conservation Analysis |
No. of Species: 28
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2116751 | 2116891 | - | NZ_LR215980.1 | Paraprevotella xylaniphila YIT 11841 |
| 2 | 2080185 | 2080331 | + | NC_015164.1 | Phocaeicola salanitronis DSM 18170 |
| 3 | 3023728 | 3023856 | + | NZ_CP015401.2 | Bacteroides caecimuris |
| 4 | 5900061 | 5900186 | + | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
| 5 | 2786269 | 2786400 | - | NZ_LR699004.1 | Phocaeicola dorei |
| 6 | 651616 | 651744 | - | NZ_CP013195.1 | Prevotella enoeca |
| 7 | 198377 | 198499 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 8 | 838142 | 838267 | + | NZ_CP017195.1 | Lactococcus paracarnosus |
| 9 | 3751302 | 3751442 | + | NZ_LN877293.1 | Bacteroides fragilis |
| 10 | 3094376 | 3094492 | + | NZ_CP070062.1 | Coprococcus comes |
| 11 | 2291063 | 2291194 | - | NZ_CP006837.1 | Lysinibacillus varians |
| 12 | 2459390 | 2459509 | - | NZ_CP059603.1 | Levilactobacillus suantsaii |
| 13 | 2361386 | 2361517 | + | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 14 | 579288 | 579404 | + | NZ_AP012325.1 | Bifidobacterium catenulatum DSM 16992 = JCM 1194 = LMG 11043 |
| 15 | 132820 | 132948 | + | NZ_CP039126.1 | Blautia producta |
| 16 | 1302929 | 1303048 | - | NZ_CP036422.1 | Halioglobus maricola |
| 17 | 2109120 | 2109236 | + | NZ_CP012033.1 | Levilactobacillus koreensis |
| 18 | 268667 | 268795 | + | NZ_CP040058.1 | Anaerostipes rhamnosivorans |
| 19 | 1932389 | 1932511 | - | NZ_CP015247.1 | Leuconostoc suionicum |
| 20 | 1789471 | 1789593 | + | NZ_CP028251.1 | Leuconostoc mesenteroides |
| 21 | 3752889 | 3753008 | + | NC_014933.1 | Bacteroides helcogenes P 36-108 |
| 22 | 154630 | 154746 | + | NC_018631.1 | Leuconostoc gelidum JB7 |
| 23 | 2948683 | 2948838 | - | NZ_CP033433.1 | Cohnella candidum |
| 24 | 1253782 | 1253910 | - | NZ_CP027231.1 | Bacteroides zoogleoformans |
| 25 | 1146715 | 1146831 | - | NZ_CP014332.1 | Weissella jogaejeotgali |
| 26 | 3010328 | 3010456 | + | NZ_CP027234.1 | Bacteroides heparinolyticus |
| 27 | 2336688 | 2336831 | + | NZ_CP012938.1 | Bacteroides ovatus |
| 28 | 687192 | 687320 | + | NZ_CP011311.1 | Corynebacterium camporealensis |
++ More..