Result : EXP02508
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02508 |
| NCBI Accession ID | |
| Organism | |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGATCTGTCTGATGATCGCCAACTTCCCGCAGTTACAGATCCTCACCGATATTATTATGTGGATCGCACTGATCCTCACCGTAGTATCTCTGATCGATTATCTCGTGAAGAACAAAGATGTTATGAAGGATACGAAGTAA |
| Sequence | MICLMIANFPQLQILTDIIMWIALILTVVSLIDYLVKNKDVMKDTK |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 46 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1597804 | 1597956 | + | NC_014387.1 | Butyrivibrio proteoclasticus B316 |
| 2 | 2106720 | 2106863 | + | NC_014376.1 | [Clostridium] saccharolyticum WM1 |
| 3 | 3041757 | 3041906 | - | NZ_CP009933.1 | Clostridium scatologenes |
| 4 | 2049622 | 2049759 | + | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 5 | 2465219 | 2465350 | - | NC_014393.1 | Clostridium cellulovorans 743B |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_014376.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03755.15 | 0.6 | 3 | 2805 | same-strand | YicC-like family, N-terminal region |
| 2 | PF08340.13 | 0.6 | 3 | 2805 | same-strand | Domain of unknown function (DUF1732) |
| 3 | PF00625.23 | 0.6 | 3 | 2129 | same-strand | Guanylate kinase |
| 4 | PF01192.24 | 0.6 | 3 | 1772 | same-strand | RNA polymerase Rpb6 |
| 5 | PF00919.22 | 1.0 | 5 | 395 | same-strand | Uncharacterized protein family UPF0004 |
| 6 | PF04055.23 | 1.0 | 5 | 408.5 | same-strand | Radical SAM superfamily |
| 7 | PF18693.3 | 1.0 | 5 | 395 | same-strand | TRAM domain |
| 8 | PF01938.22 | 0.6 | 3 | 422 | same-strand | TRAM domain |
++ More..