Protein Information |
Information Type | Description |
---|---|
Protein name | EXP02506 |
NCBI Accession ID | |
Organism | Bacillus |
Left | |
Right | |
Strand | |
Nucleotide Sequence | ATGGCTTATAAAATCAGCGACGAGTGCATCATGTGCGGCGCCTGCGAAGGCGAAGGCAAGTACGTCATCGATCCTGAAAAGTGCATCTCCTGCGGCGCTTGCGAAGGCACCTGCCCCGTTGGCGCTCCCTCTGAGGAGTAA |
Sequence | MAYKISDECIMCGACEGEGKYVIDPEKCISCGACEGTCPVGAPSEE |
Source of smORF | Metagenomic Ribo-seq |
Function | The ORF matches to the profile of pfam00037. Profile Description: 4Fe-4S binding domain. Superfamily includes proteins containing domains which bind to iron-sulfur clusters. Members include bacterial ferredoxins, various dehydrogenases, and various reductases. Structure of the domain is an alpha-antiparallel beta sandwich. |
Pubmed ID | 32601270 |
Domain | CDD:394993 |
Functional Category | Conserved domain based functional assignment |
Uniprot ID | |
ORF Length (Amino Acid) | 46 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 287361 | 287528 | + | NZ_CP035130.1 | Gudongella oleilytica |
2 | 598254 | 598421 | + | NZ_LT906446.1 | Megamonas hypermegale |
3 | 249534 | 249701 | - | NZ_CP027228.1 | Mogibacterium diversum |
4 | 5159476 | 5159643 | + | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
5 | 956581 | 956748 | + | NZ_CP048000.1 | Anaerocolumna sedimenticola |
6 | 2174028 | 2174195 | + | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
7 | 1903678 | 1903845 | - | NZ_LR027382.1 | Alistipes megaguti |
8 | 219594 | 219761 | + | NZ_LT635480.1 | Ndongobacter massiliensis |
9 | 390622 | 390789 | + | NC_018011.1 | Alistipes finegoldii DSM 17242 |
10 | 1431470 | 1431637 | - | NC_019978.1 | Halobacteroides halobius DSM 5150 |
11 | 25848 | 26015 | + | NZ_AP019735.1 | Alistipes communis |
12 | 4605787 | 4605954 | + | NC_010001.1 | Lachnoclostridium phytofermentans ISDg |
13 | 1071669 | 1071833 | + | NZ_CP009240.1 | Megasphaera elsdenii 14-14 |
14 | 1836346 | 1836510 | + | NZ_CP029462.1 | Megasphaera stantonii |
15 | 359098 | 359265 | + | NC_014632.1 | Ilyobacter polytropus DSM 2926 |
16 | 914880 | 915008 | + | NC_021169.1 | Archaeoglobus sulfaticallidus PM70-1 |