Result : EXP02506
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02506 |
| NCBI Accession ID | |
| Organism | Bacillus |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGGCTTATAAAATCAGCGACGAGTGCATCATGTGCGGCGCCTGCGAAGGCGAAGGCAAGTACGTCATCGATCCTGAAAAGTGCATCTCCTGCGGCGCTTGCGAAGGCACCTGCCCCGTTGGCGCTCCCTCTGAGGAGTAA |
| Sequence | MAYKISDECIMCGACEGEGKYVIDPEKCISCGACEGTCPVGAPSEE |
| Source of smORF | Metagenomic Ribo-seq |
| Function | The ORF matches to the profile of pfam00037. Profile Description: 4Fe-4S binding domain. Superfamily includes proteins containing domains which bind to iron-sulfur clusters. Members include bacterial ferredoxins, various dehydrogenases, and various reductases. Structure of the domain is an alpha-antiparallel beta sandwich. |
| Pubmed ID | 32601270 |
| Domain | CDD:394993 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 46 |
++ More..
| Conservation Analysis |
No. of Species: 16
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 287361 | 287528 | + | NZ_CP035130.1 | Gudongella oleilytica |
| 2 | 598254 | 598421 | + | NZ_LT906446.1 | Megamonas hypermegale |
| 3 | 249534 | 249701 | - | NZ_CP027228.1 | Mogibacterium diversum |
| 4 | 5159476 | 5159643 | + | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
| 5 | 956581 | 956748 | + | NZ_CP048000.1 | Anaerocolumna sedimenticola |
| 6 | 2174028 | 2174195 | + | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 7 | 1903678 | 1903845 | - | NZ_LR027382.1 | Alistipes megaguti |
| 8 | 219594 | 219761 | + | NZ_LT635480.1 | Ndongobacter massiliensis |
| 9 | 390622 | 390789 | + | NC_018011.1 | Alistipes finegoldii DSM 17242 |
| 10 | 1431470 | 1431637 | - | NC_019978.1 | Halobacteroides halobius DSM 5150 |
| 11 | 25848 | 26015 | + | NZ_AP019735.1 | Alistipes communis |
| 12 | 4605787 | 4605954 | + | NC_010001.1 | Lachnoclostridium phytofermentans ISDg |
| 13 | 1071669 | 1071833 | + | NZ_CP009240.1 | Megasphaera elsdenii 14-14 |
| 14 | 1836346 | 1836510 | + | NZ_CP029462.1 | Megasphaera stantonii |
| 15 | 359098 | 359265 | + | NC_014632.1 | Ilyobacter polytropus DSM 2926 |
| 16 | 914880 | 915008 | + | NC_021169.1 | Archaeoglobus sulfaticallidus PM70-1 |
++ More..