| Protein name |
EXP02503 |
| NCBI Accession ID |
|
| Organism |
Klebsiella |
| Left |
|
| Right |
|
| Strand |
|
| Nucleotide Sequence |
ATGAGCCGTGACATGCTAGAACTCATCCGCGATCGCTGGTGGAAGCTCCGCCTTTTCCGGTGCCGTGGAACTGTAATGACCGATTATCGAATTTTGAAAAACTTTGTCCGTATTTATCAGTCTCTGGGAGAAAAAGCATGA |
| Sequence |
MSRDMLELIRDRWWKLRLFRCRGTVMTDYRILKNFVRIYQSLGEKA |
| Source of smORF |
Metagenomic Ribo-seq |
| Function |
The ORF matches to the profile of NF033498. Profile Description: YlcG family protein. Members of this family include YlcG from the DLP12 prophage region of Eschichia coli K-12, and homologs from the Gifsy-1 and Gifsy-2 prophage regions of Salmonella enterica subsp. enterica serovar Typhimurium str. LT2. Members of this protein family are small, about 46 amino acids long. YlcG is known to be expressed. It is encoded immediately downstream of the Holliday junction resolvase RusA. |
| Pubmed ID |
32601270
|
| Domain |
CDD:411140 |
| Functional Category |
Conserved domain based functional assignment |
| Uniprot ID |
Q47272
|
| ORF Length (Amino Acid) |
46 |