Result : B5FJC0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Cell division activator CedA |
| NCBI Accession ID | CP001144.1 |
| Organism | Salmonella dublin (strain CT_02021853) |
| Left | 1957652 |
| Right | 1957894 |
| Strand | - |
| Nucleotide Sequence | ATGATGAAACCTCTTCGCCAGCAAAATCGCCAGATTATTAGCTATATTCCGCGTGTTGAACCCGCGCCGCCGGAACATGCGATAAAAATGGATACGTTTCGCGACGTCTGGATACTGCGCGGTAAATATGTTGCCTTTGTTCTGACGGGGGAGTCATTTCAACGGTCGCCCGCCTTTAGCGTGCCAGAATCGGCGCAACGTTGGGCGAATCAGGTTCGCCAGGAAAACGAAATCGCTGACTAA |
| Sequence | MMKPLRQQNRQIISYIPRVEPAPPEHAIKMDTFRDVWILRGKYVAFVLTGESFQRSPAFSVPESAQRWANQVRQENEIAD |
| Source of smORF | Swiss-Prot |
| Function | Activates the cell division inhibited by chromosomal DNA over-replication. {ECO:0000255|HAMAP-Rule:MF_01580}. |
| Pubmed ID | 21602358 |
| Domain | CDD:331313 |
| Functional Category | DNA-binding |
| Uniprot ID | B5FJC0 |
| ORF Length (Amino Acid) | 80 |
++ More..
| Conservation Analysis |
No. of Species: 60
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1399722 | 1399964 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 2 | 3814109 | 3814351 | + | NZ_CP053416.1 | Salmonella bongori |
| 3 | 1422762 | 1423004 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 4 | 1677747 | 1677989 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 5 | 4806424 | 4806663 | + | NZ_CP033744.1 | Citrobacter freundii |
| 6 | 3559457 | 3559699 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 7 | 263834 | 264073 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 8 | 657651 | 657890 | + | NZ_CP038469.1 | Citrobacter tructae |
| 9 | 325427 | 325669 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 10 | 3440025 | 3440267 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 11 | 2019210 | 2019452 | + | NZ_LR134340.1 | Escherichia marmotae |
| 12 | 1747982 | 1748224 | - | NZ_AP014857.1 | Escherichia albertii |
| 13 | 1532362 | 1532604 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 14 | 1813421 | 1813663 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 15 | 2413271 | 2413513 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 16 | 2185573 | 2185770 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 17 | 3015285 | 3015482 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 18 | 3222130 | 3222327 | - | NZ_CP054254.1 | Klebsiella variicola |
| 19 | 1880686 | 1880883 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 20 | 2163321 | 2163518 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 21 | 3094117 | 3094314 | - | NZ_CP041247.1 | Raoultella electrica |
| 22 | 2802603 | 2802842 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
| 23 | 2131210 | 2131407 | + | NZ_CP043318.1 | Enterobacter chengduensis |
| 24 | 3552159 | 3552401 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 25 | 3950988 | 3951185 | + | NZ_CP026047.1 | Raoultella planticola |
| 26 | 3257872 | 3258069 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 27 | 2672023 | 2672253 | + | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 28 | 1412182 | 1412412 | + | NZ_CP011602.1 | Phytobacter ursingii |
| 29 | 1590959 | 1591198 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
| 30 | 1118274 | 1118471 | + | NZ_CP017279.1 | Enterobacter ludwigii |
| 31 | 3371886 | 3372125 | - | NZ_CP050508.1 | Raoultella terrigena |
| 32 | 1874771 | 1874968 | + | NC_015968.1 | Enterobacter soli |
| 33 | 1850060 | 1850257 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
| 34 | 1898246 | 1898443 | + | NZ_CP009756.1 | Enterobacter cloacae |
| 35 | 644128 | 644325 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 36 | 1914860 | 1915057 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
| 37 | 2591508 | 2591747 | - | NZ_CP045845.1 | Kluyvera intermedia |
| 38 | 4376438 | 4376635 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 39 | 990792 | 991034 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 40 | 3143352 | 3143594 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 41 | 3405601 | 3405843 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 42 | 2087783 | 2088025 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 43 | 2071427 | 2071666 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 44 | 2041065 | 2041307 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 45 | 2186788 | 2187018 | - | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 46 | 3241842 | 3242087 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 47 | 1037719 | 1037961 | - | NZ_CP016337.1 | Kosakonia sacchari |
| 48 | 1820300 | 1820530 | + | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 49 | 3640026 | 3640256 | + | NZ_CP042941.1 | Atlantibacter hermannii |
| 50 | 1564941 | 1565171 | - | NZ_CP027107.1 | Cronobacter sakazakii |
| 51 | 1849069 | 1849299 | + | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 52 | 2661387 | 2661626 | - | NZ_CP035129.1 | Kosakonia cowanii |
| 53 | 774542 | 774739 | + | NZ_CP023529.1 | Lelliottia amnigena |
| 54 | 2628143 | 2628340 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 55 | 1816345 | 1816575 | + | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 56 | 2348721 | 2348951 | - | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 57 | 1639326 | 1639556 | + | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 58 | 3469723 | 3469953 | + | NZ_CP040428.1 | Jejubacter calystegiae |
| 59 | 2703835 | 2704071 | - | NZ_LR134201.1 | Cedecea lapagei |
| 60 | 2941228 | 2941464 | - | NZ_CP023525.1 | Cedecea neteri |
| 61 | 2644465 | 2644704 | - | NZ_AP023184.1 | Buttiauxella agrestis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_013716.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02255.18 | 0.65 | 39 | 5636.0 | same-strand | PTS system, Lactose/Cellobiose specific IIA subunit |
| 2 | PF12833.9 | 0.68 | 41 | 4777.0 | same-strand | Helix-turn-helix domain |
| 3 | PF00165.25 | 0.68 | 41 | 4777.0 | same-strand | Bacterial regulatory helix-turn-helix proteins, AraC family |
| 4 | PF02056.18 | 0.7 | 42 | 3319 | same-strand | Family 4 glycosyl hydrolase |
| 5 | PF11975.10 | 0.7 | 42 | 3319 | same-strand | Family 4 glycosyl hydrolase C-terminal domain |
| 6 | PF04794.14 | 0.7 | 42 | 2548 | same-strand | YdjC-like protein |
| 7 | PF00199.21 | 0.78 | 47 | 216.0 | opposite-strand | Catalase |
| 8 | PF06628.14 | 0.78 | 47 | 216.0 | opposite-strand | Catalase-related immune-responsive |
| 9 | PF18011.3 | 0.78 | 47 | 216.0 | opposite-strand | C-terminal domain found in long catalases |
| 10 | PF00375.20 | 0.97 | 58 | 64 | opposite-strand | Sodium:dicarboxylate symporter family |
| 11 | PF04307.16 | 0.98 | 59 | 1588.5 | opposite-strand | LexA-binding, inner membrane-associated putative hydrolase |
| 12 | PF13419.8 | 0.87 | 52 | 3168 | opposite-strand | Haloacid dehalogenase-like hydrolase |
| 13 | PF14002.8 | 0.82 | 49 | 3978.5 | same-strand | YniB-like protein |
| 14 | PF13561.8 | 0.63 | 38 | 2278.0 | opposite-strand | Enoyl-(Acyl carrier protein) reductase |
| 15 | PF00106.27 | 0.63 | 38 | 2278.0 | opposite-strand | short chain dehydrogenase |
++ More..