Result : EXP02499
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02499 |
| NCBI Accession ID | |
| Organism | Peptoanaerobacter |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | GTGGCTCTAGAGGCCGTGGGTTCGAATCCCACCCCCTCCGCCATATTTGCCCAGATAGCTCAGTCGGTAGAGCAGAGGACTGAAAATCCTCGTGTCGATGGTTCGATTCCGTCTCTGGGCACCATTTATAGGGGCCTTTAG |
| Sequence | MALEAVGSNPTPSAIFAQIAQSVEQRTENPRVDGSIPSLGTIYRGL |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 46 |
++ More..
| Conservation Analysis |
No. of Species: 22
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2481856 | 2481999 | - | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 2 | 257723 | 257863 | - | NZ_CP026363.1 | Brevibacillus agri |
| 3 | 156328 | 156477 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 4 | 156241 | 156390 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 5 | 863103 | 863261 | + | NZ_CP032416.1 | Clostridium fermenticellae |
| 6 | 4963142 | 4963291 | - | NZ_CP040336.1 | Bacillus luti |
| 7 | 150849 | 150998 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 8 | 759740 | 759883 | - | NC_016630.1 | Filifactor alocis ATCC 35896 |
| 9 | 391982 | 392104 | + | NZ_LR215023.1 | Mycoplasma iowae |
| 10 | 157368 | 157517 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 11 | 4875098 | 4875217 | - | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 12 | 3438803 | 3438946 | + | NZ_CP023567.1 | Erwinia pyrifoliae |
| 13 | 184841 | 184960 | + | NZ_CP030775.1 | Clostridium butyricum |
| 14 | 267075 | 267203 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 15 | 356954 | 357067 | - | NZ_CP031123.2 | Providencia huaxiensis |
| 16 | 107836 | 107958 | + | NZ_CP023536.1 | Providencia alcalifaciens |
| 17 | 1897582 | 1897707 | - | NZ_AP019004.1 | Phascolarctobacterium faecium |
| 18 | 797783 | 797899 | - | NZ_CP071376.1 | Clostridium gasigenes |
| 19 | 797006 | 797122 | - | NZ_CP071376.1 | Clostridium gasigenes |
| 20 | 198404 | 198547 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 21 | 2681380 | 2681502 | - | NZ_CP053840.1 | Arcobacter venerupis |
| 22 | 2251274 | 2251417 | - | NZ_CP060782.1 | Sphingomonas sediminicola |
| 23 | 2647903 | 2648049 | + | NZ_AP021889.1 | Thiosulfatimonas sediminis |
++ More..