Result : EXP02492
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02492 |
| NCBI Accession ID | |
| Organism | Coprobacillus |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGGCGATTTATAAAAAAATAAAGCTTAATGCTTTTAATGCCGATTTAGCTCAATTGGTAGAGCAGCTGAATCGTAATCAGAAGGTTGAGGGTTCAAGTCCTTTAATCGGCACCAGTGACGAATCTGTTCGAACTATTTGA |
| Sequence | MAIYKKIKLNAFNADLAQLVEQLNRNQKVEGSSPLIGTSDESVRTI |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 46 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 565323 | 565475 | + | NZ_CP047141.1 | Ligilactobacillus animalis |
| 2 | 167094 | 167225 | - | NZ_CP019323.1 | Companilactobacillus allii |
| 3 | 676967 | 677080 | + | NC_008525.1 | Pediococcus pentosaceus ATCC 25745 |
| 4 | 620597 | 620710 | + | NZ_CP053421.1 | Pediococcus acidilactici |
| 5 | 407807 | 407926 | + | NZ_CP007032.1 | Desulfitobacterium metallireducens DSM 15288 |
| 6 | 969400 | 969522 | - | NZ_CP007446.1 | Snodgrassella alvi wkB2 |
++ More..