Result : EXP02471
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02471 |
| NCBI Accession ID | |
| Organism | Streptococcus |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGGTAAATCAAAACGGAATCCTTGTTTGTACGGCTGTTTCTGAACATAGTTTCTTGTCTAAGGACGGTGGTTTTGTCAATCTTAAAAGAGATCATTTGTCATTTTTTAATCTTTTAAAAGAGCATTCAGTTATGCAATAA |
| Sequence | MVNQNGILVCTAVSEHSFLSKDGGFVNLKRDHLSFFNLLKEHSVMQ |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 46 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1753848 | 1753985 | - | NZ_LR134275.1 | Streptococcus vestibularis |
| 2 | 1726910 | 1727050 | - | NC_017581.1 | Streptococcus thermophilus JIM 8232 |
| 3 | 1162634 | 1162774 | - | NZ_LS483343.1 | Streptococcus ferus |
| 4 | 866049 | 866183 | - | NZ_CP013237.1 | Streptococcus mutans |
| 5 | 1361323 | 1361457 | - | NZ_AP014612.1 | Streptococcus troglodytae |
| 6 | 360488 | 360628 | + | NZ_CP029491.1 | Streptococcus sobrinus |
++ More..