Result : EXP02465
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02465 |
| NCBI Accession ID | |
| Organism | Corynebacterium |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGGCTGTGGCGGAGTCGATGCCAACGTCTGTAGAGGAACTGCTGGGTATCTCTGGTATCGGGCCAGTGAAGGTCGAACGTTTCGGGGAAGAGCTGTTGGCTGTCATTCGAACATGTGCTGAAGCATCGGACGTTTCATAG |
| Sequence | MAVAESMPTSVEELLGISGIGPVKVERFGEELLAVIRTCAEASDVS |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 46 |
++ More..
| Conservation Analysis |
No. of Species: 18
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 726486 | 726608 | + | NZ_CP006764.1 | Corynebacterium doosanense CAU 212 = DSM 45436 |
| 2 | 1480548 | 1480670 | - | NZ_CP042941.1 | Atlantibacter hermannii |
| 3 | 851264 | 851380 | + | NC_004369.1 | Corynebacterium efficiens YS-314 |
| 4 | 839280 | 839405 | + | NZ_LS483459.1 | Corynebacterium jeikeium |
| 5 | 751351 | 751470 | + | NC_020506.1 | Corynebacterium callunae DSM 20147 |
| 6 | 605194 | 605343 | + | NZ_CP026948.1 | Corynebacterium liangguodongii |
| 7 | 1025501 | 1025626 | + | NZ_CP006842.1 | Corynebacterium glyciniphilum AJ 3170 |
| 8 | 3072120 | 3072236 | + | NZ_CP042429.1 | Corynebacterium nuruki S6-4 |
| 9 | 1396165 | 1396293 | + | NZ_HG938353.1 | Neorhizobium galegae bv. orientalis str. HAMBI 540 |
| 10 | 1180760 | 1180912 | + | NZ_CP045529.1 | Luteimicrobium xylanilyticum |
| 11 | 1321066 | 1321194 | + | NC_022116.1 | Amycolatopsis mediterranei RB |
| 12 | 2756701 | 2756826 | - | NZ_FO082820.1 | Pseudorhizobium banfieldiae |
| 13 | 2923757 | 2923882 | - | NZ_LR723670.1 | Pseudorhizobium flavum |
| 14 | 1989297 | 1989413 | - | NC_021663.1 | Corynebacterium terpenotabidum Y-11 |
| 15 | 4737072 | 4737221 | - | NZ_CP015163.1 | Amycolatopsis albispora |
| 16 | 3793202 | 3793330 | - | NZ_LS483470.1 | Leminorella richardii |
| 17 | 3479546 | 3479665 | - | NC_014165.1 | Thermobispora bispora DSM 43833 |
| 18 | 1122549 | 1122686 | + | NZ_CP049934.1 | Leucobacter insecticola |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP006764.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00580.23 | 0.61 | 11 | 5372 | same-strand | UvrD/REP helicase N-terminal domain |
| 2 | PF13245.8 | 0.61 | 11 | 5565 | same-strand | AAA domain |
++ More..