| Protein name |
EXP02461 |
| NCBI Accession ID |
|
| Organism |
Faecalibacterium,Clostridium |
| Left |
|
| Right |
|
| Strand |
|
| Nucleotide Sequence |
ATGAAAAAAATAGTGTATTGGCTGAGCAGGCTCACTTGCATTATTGCAATGGGAATGGCCGTAGCAAGTGTAAATAGCACTTGTTTCTTTACTGCATATCAGCCAGACATTCCGGAATCTTTGGAAAAGTTTGGTTCATAA |
| Sequence |
MKKIVYWLSRLTCIIAMGMAVASVNSTCFFTAYQPDIPESLEKFGS |
| Source of smORF |
Metagenomic Ribo-seq |
| Function |
The ORF matches to the profile of cl27940. Profile Description: Staphylococcal AgrD protein. Members of this family of short peptides are precursors to thiolactone (unless Cys is replaced by Ser) cyclic autoinducer peptides, used in quorum-sensing systems in Gram-positive bacteria. The best characterized is the AgrD precursor, processed by the AgrB protein. Nearby proteins regularly encountered include a histidine kinase and a response regulator. This model is related to pfam05931 but is newer and currently broader in scope. |
| Pubmed ID |
32601270
|
| Domain |
CDD:391800 |
| Functional Category |
Conserved domain based functional assignment |
| Uniprot ID |
|
| ORF Length (Amino Acid) |
46 |