Result : EXP02459
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02459 |
| NCBI Accession ID | |
| Organism | Peptoanaerobacter |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGAAGAAGAAAAAATCTGTTCCGTATATTTTAATTGTCTTGGCGATAATTTTAATTGTAGTCGGAATAAACAGAGGAGATTTGAAAGGTGTGCTTAACAAATCCGTTCATATATGTATGGAATGTATAGGCATAGGGTAG |
| Sequence | MKKKKSVPYILIVLAIILIVVGINRGDLKGVLNKSVHICMECIGIG |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 46 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2403530 | 2403667 | + | NC_002967.9 | Treponema denticola ATCC 35405 |
| 2 | 2464011 | 2464136 | + | NC_022097.1 | Treponema pedis str. T A4 |
| 3 | 1114379 | 1114516 | + | NZ_CP014176.1 | Clostridium argentinense |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_022097.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00578.23 | 0.67 | 2 | 577 | same-strand | AhpC/TSA family |
| 2 | PF08534.12 | 0.67 | 2 | 577 | same-strand | Redoxin |
| 3 | PF13905.8 | 0.67 | 2 | 289.0 | same-strand | Thioredoxin-like |
| 4 | PF12801.9 | 0.67 | 2 | -2.5 | same-strand | 4Fe-4S binding domain |
| 5 | PF00005.29 | 0.67 | 2 | 3113.0 | both-strands | ABC transporter |
| 6 | PF00664.25 | 0.67 | 2 | 3113.0 | both-strands | ABC transporter transmembrane region |
++ More..