Result : B5E3R6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | D-alanyl carrier protein (DCP) (D-alanine--poly(phosphoribitol) ligase subunit 2) |
| NCBI Accession ID | CP001015.1 |
| Organism | Streptococcus pneumoniae serotype 19F (strain G54) |
| Left | 2008284 |
| Right | 2008523 |
| Strand | - |
| Nucleotide Sequence | ATGGATATCAAATCAGAAGTTATTGAAATTATTGATGAGTTGTTTATGGAAGATGTTTCTGACATGATGGATGAAGATCTTTTTGATGCAGGTGTCTTGGATAGTATGGGAACGGTTGAGTTGATTGTGGAGATTGAGAACCGTTTTGACATTCGTGTCCCTGTAACAGAGTTTGGTCGTGACGACTGGAATACAGCTAATAAAATCATAGCTGGTATTGTGGAGCTACAAAATGCTTAA |
| Sequence | MDIKSEVIEIIDELFMEDVSDMMDEDLFDAGVLDSMGTVELIVEIENRFDIRVPVTEFGRDDWNTANKIIAGIVELQNA |
| Source of smORF | Swiss-Prot |
| Function | Carrier protein involved in the D-alanylation of lipoteichoic acid (LTA). The loading of thioester-linked D-alanine onto DltC is catalyzed by D-alanine--D-alanyl carrier protein ligase DltA. The DltC-carried D-alanyl group is further transferred to cell membrane phosphatidylglycerol (PG) by forming an ester bond, probably catalyzed by DltD. D-alanylation of LTA plays an important role in modulating the properties of the cell wall in Gram-positive bacteria, influencing the net charge of the cell wall. {ECO:0000255|HAMAP-Rule:MF_00565}. |
| Pubmed ID | 11442348 |
| Domain | CDD:415812 |
| Functional Category | Others |
| Uniprot ID | B5E3R6 |
| ORF Length (Amino Acid) | 79 |
++ More..
| Conservation Analysis |
No. of Species: 62
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1867118 | 1867357 | + | NZ_CP032621.1 | Streptococcus gwangjuense |
| 2 | 2129677 | 2129916 | - | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 3 | 1858286 | 1858525 | - | NZ_LR134336.1 | Streptococcus oralis ATCC 35037 |
| 4 | 615016 | 615210 | + | NZ_CP032620.1 | Streptococcus koreensis |
| 5 | 1948416 | 1948655 | - | NZ_LS483383.1 | Streptococcus cristatus ATCC 51100 |
| 6 | 56725 | 56964 | + | NZ_LR594049.1 | Streptococcus gordonii |
| 7 | 788329 | 788568 | + | NZ_LR134275.1 | Streptococcus vestibularis |
| 8 | 446496 | 446735 | + | NZ_AP014612.1 | Streptococcus troglodytae |
| 9 | 662678 | 662917 | + | NZ_CP016953.1 | Streptococcus himalayensis |
| 10 | 1034156 | 1034395 | + | NZ_CP015196.1 | Streptococcus marmotae |
| 11 | 806030 | 806269 | + | NC_017581.1 | Streptococcus thermophilus JIM 8232 |
| 12 | 597687 | 597926 | + | NZ_CP022680.1 | Streptococcus respiraculi |
| 13 | 1852207 | 1852446 | - | NZ_CP034543.1 | Streptococcus periodonticum |
| 14 | 1874655 | 1874894 | - | NZ_CP012805.1 | Streptococcus anginosus |
| 15 | 31836 | 32075 | + | NZ_CP013237.1 | Streptococcus mutans |
| 16 | 247769 | 248008 | + | NZ_CP029491.1 | Streptococcus sobrinus |
| 17 | 1879309 | 1879548 | - | NZ_LS483436.1 | Streptococcus intermedius |
| 18 | 1517583 | 1517822 | + | NZ_CP043405.1 | Streptococcus ratti |
| 19 | 1603374 | 1603613 | - | NZ_LS483403.1 | Streptococcus lutetiensis |
| 20 | 1725653 | 1725892 | - | NZ_LR134512.1 | Streptococcus agalactiae |
| 21 | 624103 | 624342 | + | NC_012924.1 | Streptococcus suis SC84 |
| 22 | 1966238 | 1966477 | - | NZ_CP039457.1 | Streptococcus pasteurianus |
| 23 | 602034 | 602273 | - | NZ_CP054015.1 | Streptococcus gallolyticus |
| 24 | 1400608 | 1400847 | - | NZ_AP018400.1 | Streptococcus ruminantium |
| 25 | 922205 | 922444 | - | NZ_CP061835.1 | Weissella viridescens |
| 26 | 2140068 | 2140307 | + | NZ_CP023392.1 | Lactococcus raffinolactis |
| 27 | 716085 | 716324 | + | NZ_CP065061.1 | Streptococcus equi subsp. zooepidemicus |
| 28 | 1027310 | 1027549 | - | NZ_CP017195.1 | Lactococcus paracarnosus |
| 29 | 1019224 | 1019463 | - | NZ_CP010450.1 | Streptococcus pyogenes |
| 30 | 1386000 | 1386239 | + | NZ_LR134293.1 | Streptococcus canis |
| 31 | 1345381 | 1345620 | - | NZ_LR594046.1 | Streptococcus dysgalactiae |
| 32 | 987156 | 987395 | - | NZ_CP017194.1 | Lactococcus carnosus |
| 33 | 477307 | 477546 | - | NZ_LR134341.1 | Streptococcus pseudoporcinus |
| 34 | 725950 | 726144 | + | NZ_LR594050.1 | Streptococcus porcinus |
| 35 | 293190 | 293426 | + | NZ_CP065993.1 | Leuconostoc pseudomesenteroides |
| 36 | 358498 | 358734 | + | NZ_CP042410.1 | Leuconostoc citreum |
| 37 | 1758568 | 1758804 | - | NZ_CP015247.1 | Leuconostoc suionicum |
| 38 | 1952423 | 1952659 | + | NZ_CP028251.1 | Leuconostoc mesenteroides |
| 39 | 680018 | 680254 | + | NC_018631.1 | Leuconostoc gelidum JB7 |
| 40 | 1663458 | 1663694 | + | NC_014136.1 | Leuconostoc kimchii IMSNU 11154 |
| 41 | 470835 | 471071 | - | NZ_CP042374.1 | Leuconostoc carnosum |
| 42 | 1734462 | 1734704 | - | NZ_CP053421.1 | Pediococcus acidilactici |
| 43 | 245034 | 245270 | - | NZ_CP011937.1 | Bacillus velezensis |
| 44 | 3795093 | 3795329 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 45 | 2281551 | 2281787 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 46 | 3777420 | 3777656 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 47 | 3769967 | 3770203 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 48 | 3842921 | 3843157 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 49 | 3954987 | 3955223 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 50 | 1719290 | 1719526 | + | NZ_CP012294.1 | Pediococcus damnosus |
| 51 | 3782436 | 3782672 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 52 | 1203791 | 1204027 | - | NZ_CP019981.1 | Pediococcus inopinatus |
| 53 | 4366881 | 4367117 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 54 | 1550880 | 1551116 | + | NZ_CP023643.1 | Brochothrix thermosphacta |
| 55 | 3837390 | 3837626 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 56 | 2659709 | 2659942 | + | NZ_CP012033.1 | Levilactobacillus koreensis |
| 57 | 1356112 | 1356345 | - | NZ_LS483405.1 | Levilactobacillus brevis |
| 58 | 513489 | 513725 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 59 | 907875 | 908078 | - | NZ_CP030105.1 | Lactiplantibacillus plantarum |
| 60 | 1458322 | 1458558 | - | NZ_CP030105.1 | Lactiplantibacillus plantarum |
| 61 | 1476066 | 1476302 | - | NZ_CP032757.1 | Lactiplantibacillus pentosus |
| 62 | 1269715 | 1269954 | - | NC_022369.1 | Lactococcus lactis subsp. cremoris KW2 |
| 63 | 876491 | 876730 | - | NZ_CP032627.1 | Lactococcus allomyrinae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP032620.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04914.14 | 0.97 | 60 | -7 | same-strand | DltD protein |
| 2 | PF00501.30 | 0.98 | 61 | 1256 | same-strand | AMP-binding enzyme |
| 3 | PF13193.8 | 0.94 | 58 | 1257.0 | same-strand | AMP-binding enzyme C-terminal domain |
| 4 | PF12459.10 | 0.68 | 42 | 2815.5 | same-strand | D-Ala-teichoic acid biosynthesis protein |
++ More..