Result : A1AIS9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YtcA |
| NCBI Accession ID | CP000468.1 |
| Organism | Escherichia coli O1:K1 / APEC |
| Left | 4650793 |
| Right | 4651068 |
| Strand | - |
| Nucleotide Sequence | ATGCCAACAGTTCTCTCTCGCATGGCGATGCAACTCAAAAAAACAGCCTGGATAATTCCCGTCTTCATGGTTTCGGGATGCTCATTATCTCCGGCAATCCCGGTGATCGGCGCTTATTATCCCGGCTGGTTTTTCTGCGCTATTGCCAGCCTTATTTTGACGCTCATCACGAGGCGAATTATTCAGCGGACAAATATCAATCTGGCATTTGTCGGAATTATTTATACCGCCCTTTTTGCTCTCTACGCCATGCTGTTCTGGCTGGCATTTTTCTAA |
| Sequence | MPTVLSRMAMQLKKTAWIIPVFMVSGCSLSPAIPVIGAYYPGWFFCAIASLILTLITRRIIQRTNINLAFVGIIYTALFALYAMLFWLAFF |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam17090. Profile Description: Uncharacterized protein family. This is a family of bacterial transmembrane proteins. The function is unknown. |
| Pubmed ID | 17293413 |
| Domain | CDD:374980 |
| Functional Category | Others |
| Uniprot ID | A1AIS9 |
| ORF Length (Amino Acid) | 91 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4304128 | 4304403 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 5156940 | 5157215 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 3 | 348076 | 348351 | - | NZ_LR134340.1 | Escherichia marmotae |
| 4 | 4337487 | 4337762 | - | NZ_AP014857.1 | Escherichia albertii |
| 5 | 3379409 | 3379684 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 6 | 4303530 | 4303805 | + | NZ_CP045845.1 | Kluyvera intermedia |
| 7 | 3094757 | 3095032 | - | NZ_CP033744.1 | Citrobacter freundii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP014857.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01568.23 | 1.0 | 6 | 5230 | same-strand | Molydopterin dinucleotide binding domain |
| 2 | PF04879.18 | 1.0 | 6 | 4762 | same-strand | Molybdopterin oxidoreductase Fe4S4 domain |
| 3 | PF02321.20 | 1.0 | 6 | 3098 | same-strand | Outer membrane efflux protein |
| 4 | PF13515.8 | 1.0 | 6 | 1051 | same-strand | Fusaric acid resistance protein-like |
| 5 | PF13437.8 | 1.0 | 6 | 20 | same-strand | HlyD family secretion protein |
| 6 | PF13533.8 | 1.0 | 6 | 20 | same-strand | Biotin-lipoyl like |
| 7 | PF00529.22 | 1.0 | 6 | 20 | same-strand | Cation efflux system protein CusB domain 1 |
| 8 | PF14863.8 | 0.83 | 5 | 209.0 | same-strand | Alkyl sulfatase dimerisation |
| 9 | PF00753.29 | 0.83 | 5 | 209.0 | same-strand | Metallo-beta-lactamase superfamily |
| 10 | PF14864.8 | 0.83 | 5 | 209.0 | same-strand | Alkyl sulfatase C-terminal |
| 11 | PF04632.14 | 0.67 | 4 | 1051.0 | same-strand | Fusaric acid resistance protein family |
++ More..